Chershoee
id Protein Name UniProt ID Sequence Length
1 Membrane protein A20A G8XUB5 MWLGLVAIVAGCTTIAAAFFKFTSIYHFVLFVAILTTVAVFTLDLIALLVYQLVMDTLHE LVHEFPRRSANEKRHRCHDSVLIIVIEA 88
2 Membrane protein A46 G8XUM4 MRPITRFLLVGLGIVLCLQFTMWLMWCEPRDRTGSGGRAGARRGGLEVVDWVEYGPPRPS AEEYIELCNKWDYDNVLNNYENVKSVRRLLRGDNTLDPDIKRGVMIRCYAFTPEDHTQCS VTWVQPECKVVGGKVSAKMTIEGPFTNMVHITGCVMMDGDRDNRECTKYAAAEFKNHSQY DIRMETSVGGVRGKTLMISLTACGLAISSHTCELELDVSWNPMSWYNLHDLVRLVYERRW LALCWVCVIMLGHVVAGATMLLEIMDFNDWLDRMGLKMALFVCLMLSVILYVYLITLVMR EMGWTVTDILSGQAVRELW 319
3 Membrane protein A45 G8XUM3 MPTEPRATWLRTHVYFQPPLLLVLFAVTFLYIHSEPTPSLLFAMEGSNVTFKTGFRPSSG LRKVTWYFQNTSQKLAEASQGQTTYYGRCSQRCYLNATNAFLTIPKVGKPDSGTYLVHVT THQGTTLGAKVILVVYFKLLAGPNVTARVSSTAPGKPCVMSIECSYNRSCHESWMNCTWY TLRDGNNPHRLSGHNPTTISFSLGNGRTPCYLCNASTPREHRVTSICFNNCTNQYVHTIL PTTTQRPKTTSRTTPRTTLRTTPKSTTTSKTTTTKATSKPTSRPTPKPLPTTTRKPQTMA RTTSSPTTRSSPKTIIVQTPSPPTTAPTSLPPVTEILTLMDIFSTPVLWEVHNTSCSECN STLGYATQKWPWGPLIFMVFVVLIIIMILLYLYRRRLTTQYIPGHMTMRQFFR 413
4 Membrane protein A44 G8XUM2 MPVMNVCWCCLLFVSGGWCSVTVRSGIIILGALVGIVYSNLPVNAIVGGNATIKVSQALP ANVINITWLCNSDTKVVDWNNNSHGRPLTNNHSHFTGRVQLDSNTGVLYLWNITKADMGL YTRRIFKSDNSQQDHMVKVNVYEILTTPNITLVNATVGSNMCDVYLSCSYHNYLCKKSSK NCTWYYWDKNMSHPFPWYHSAKVNSCYTCEFKNPVQRINTTLCIENCNQTKMETFSETNI ILAITSVRRHSMISVALSAVAVLCVILYRGYMYAK 275
5 Membrane protein A43 G8XUM1 MNNSYLWLPVSLGLITLSLLRVGGDSVNIVNALVGGNITLNISESLPENVREITWFCTYD QKIADWDVKRLKYFDNKFKGRVRLDSQSGALYLSRVQKEDANIYIMRVLKDTMFEQDWKI RLQVFDEVDTPNITLVNTTLISDTCYVNFSCSHHDSLCYTSNENCTWYHFSQNITKTPPW NHSASSNSCYTCEFKNPVHRKNITMCISGCGQTGIKALATRSPRRYAITFIVMILVAVLC TLSYCAYTYGVRDAMSCTFGAFIGFRARFSTLRYLLWQL 279
6 Membrane protein A40 G8XUL8 MLRRRPQSSSAGADHATSTPRHSDDGRAPASPDNERSKVTPLTDAEYTICTVLLLSIHTV IWGVTVLLVYYVPKFFALTRGREASTVSLLTVVTMLYMLLDHLDLKAPWNHCFLSASSVL TGIVTVALIPSVGTSDVVQVNLCVVMISIVATVYIYRMHRHVFVFNRRSIFAYVLFVATL MWLASQVWTPKRIMVALACTVVMLVETSYEAHRPRWERAQAGKSFMVQFAALYMDIVIFC YTAVMIRCMK 250
7 Membrane protein A39 G8XUL7 MSTLVTVSGSSRVGSPESPGTMMQECSQAEYKAVRDQSRGTASVPQRNIWVDWQPITNEL NEEHRRHLCLVYILFLGNVWVAIVASLVSYVPILRELVRNNAILLIYCAILVCLMYLFIQ FYEHRHPWNPLASVVYVTIGICVGVSTTCILSFYKDTFHATLSYGCTFIAVLFILIFVSR TTCNLSFALLVSLIAGAPMIMVVGLVWLFHSTPGVTLVLAIVCIGEMALMVTFELYQQWH FPLEFQLSPMTRALNLFMYVTVLCYVLFIAEYYMIIKSKTHTST 284
8 Membrane protein A38 G8XUL6 MKYQPSVAITINPKRDEETAKMPAEKITENTPPVKAFPYPFDLIPPTFIGEIYWLFIILV WVTAIFVCVSFTVWVFQIGPEGISDKNVLLVYGPHTVCVCSVLALCCALIILWRNPAAPY GYCISFVYSLMPAFLGLTLCCGLFFFSVKGGMLASLVSLAILWSLAWYVHNTKRDLRIVG YFVLGWTPLYVMVIIMLVRGAPLATLFGFMWMVYMGGMIMFQLYIQLHCPLNGLNPMVYA CSLYFLVMLFYLGTIVCLYDWLP 263
9 Membrane protein A37 G8XUL5 MKYQRLNNETECQPDKGKQDAVKIALSGEHRCTGQRNGSPTPNRASQTGNDTHMNPHELR TKIYKMLFADLWSTAVSICGVFTWFTIMKFSQETRKIALMFNYIHITVPVAFFVGLSAAA FIAVKNPVWPYKWYLIGTCILTTAALSYVLCCGLMLYTVKTGIISLLFACAVLGLLAWCT HHTKPNPQLAGRLVLACVPLHVMLLTMFSQGAPVLPVLGLAWMVQVGAAILYQLCIQQQS NLGEVTPMVYAHSLYISVVFFYIGSMVGLYDWLH 274
10 Membrane protein A36 G8XUL4 MKYQVLKNPVEKKTDEEVDYDGLVEIVFGKQHDAPTDEEHDTVRVDLPWKPNHATEATDT TKDTKTADKNDKTVGHVCLDREKFITEIHKTFTLNIWATALAMCMVFTWYALLGYSGETA KEMHLFKYSYIVVPVSCLVTLCAFVVTAIKNPTRPYSWGVSCMYAMISAPLSLVLSCGLT FYTVKTATLEILFAVAILCVLAWYAYHTERDLRFMGQFILGCVPLFVMTGTMFVAGQPVL PLLGLIWMLQLGAMIVYQLHIQLHRPLGGLNPLVYAASLYVLVIFFIIGTMLCLHDWFQ 299
11 Membrane protein A35 G8XUL3 MEPTVSTELQTDPQAPPMPTLAQQSRIVTCTRCRRTVCSACGRVVAGHKAPDAEEMAART RHLRNIYLLLGYQLLVITPTVLIIALVPHLYAANRTGMFMLLAAILVVATLLEMDRRPSH PSDIILLTFSSALLGSLASSTASLHTVTEIWQAAVGTAIIYVSLVFYVHQKKRNLACLID CLYVGLGTLTVLGIMWLISPWNNGKLVLSYLCTVLTCMITAYEIHVERWFPLREQRSAIL RSATLAMDLFFLGCSVLAMRHLAFP 265
12 Membrane protein A34 G8XUL2 MLISVIMDLTIYMMVCTCYFCFYYPTLQDMAWRGAVEEKTEDLADDGEYVKNHSECFMRN GMIYARWTLSDEAAIDTGVNAYWEIPTHRGPLEVKTRRFGTDIQYLVENASVPIQCDVIL LHLHRCVSACKRSVFSCVPKLRYTGWLFSRPEYTWADSWRAFYENRLWLCAWLEAIIAVR YLGWLIPLLWILKELRLGNNPPFHIEWWRRYC 212
13 Protein US26 G8XUL1 MALQSSYRYVAAPKVRSTLRSFRDFIISQDSRYDIRTLVCERHKKRVSTAIPAPPGWRLH FAPYNAVFGNGDEDDTLPLPWEPLMCCDNPLEVLGVLRYTEPGTDAQGPQDSDEEDYDEV RPPGEGPDGRPDRSPVLLMGRYETIWCFDRVQTTLYNVASSFDSLARKGLLHLEILYRQP EMQSFQLTEYPGQIVSELLQASKESLSELRRTLCRHRWQMLSLRTPGEQTRLLQLCSCPF DVQAFWPFMCMDAESLEELFTTLAEQLCCRGLVLGTVGECLPSGVFHAEYVLLVDETGCV YYFSIIARELWKLADDLTMLFRIGLMKLYTKGTRFNTARGDAEQLEVPGRCPHQMHSMWD RYSHVEYLSGARNYKARYHWLIRYDRFETDDFSASCFRRNGGDAAVGAADGSWNPRYRYD LPQEAEVNTALEHWKRYARGTNSLPYPPRTQNYSIVVDAELSAEVHRLKQTTDCSSSASF DVDEEDVEDAKTIALRRVAKTVIREGKQPVYPDIPKPGYYIPPWM 525
14 Tegument protein US24 G8XUK9 MQQEHPRPTNETLRVSLPRDTMELQQQVLKDFKDLFLCVTPVDVMEYVRLHRKELLCLGR PGRWYVLLKSDACTLDVKTRALRRLCCVEPLCLLGPAVVIINTGASRMTAVDYVVTPFLM FWGSCSRLYAYDTFQDTLLLVAHHLDELARYGVSQSEMAYRDSVHMAVRRATNGPYAPAK TSRSMHVLFLNSSTPDGTYATVERLCGSDVKLHTPGYGPRILRLVKTVSRLRAVWPFNTL TDQESERWWSNLKANIATPWYLLGVVGTPREGKPFQAEMLVLLDWFGAAYVVQMEDPSHH VRRVADSLTELFRMGLLKYYFRNRRFDEDSTMKTRLEFPSSCPHQEERGVRRMREILFNK NNTLDTEEQKRRQRRLLRQHYDWLCLKGRFDPTQGAWERRDPNTLVIHRFDCNSDTYVVD PHVTGLAEAERCATINAHDIGPRIHCLVATRSRQPESRRRVIPALVAQSRYITYSDPFPL KTLAGLRDPTVRFD 495
15 Protein US23 G8XUK8 MWRNRWERHWGLPRGSSEAALYCHTKRPVFLRVMEDFRYIFTHQDNRALLREYIQRRVDQ KLSLGIPYNWFLQLMPEDMMPELSDQLMDDIICCEERLMPLGRCVVAVGGPGQRYEDTGL LMFLGDCCRLYLYDPRTEVINMAAENSDELARFGVIGCELMYRQPTTPYATVVPEDVVQG LLARDGNVEELSAYVGEHHERDVNLHTPGRRAKTLKLVANCGCLHDYWPFEAVDPWRLAA CQVAITVRLRCRWYLLGAVGSYRCGGVFMVSKLVIFDRFGRIYVVVIRNGNYRSPASWMH KIPGETHRLADNLQEFFKAGFIKMYFRRRHEHYLRRVARLERRPKCIHAPVITLPQRTFL QLGVGQDTERQYVWLCREGRFRPEMLTTWDAWDAFAVWQDRVSRGRPSVVPRPVNQAPAG RDDEDDEDEDEEDNPPAAAVRQGDRVRHDEESGDSESSDDEEEWEDLGFDVTEDIIYSAE EDRQIPHDPQTVEWWFEQKAVADGYMTEHNVTEADVEARRIAAMDQPIPHQFRQAFDLRE FYE 543
16 Tegument protein US22 G8XUK7 MAVLPKTTAMAWSQYLKTHDDRAEDVVRCEFGPMYTRKSIFHQTMLMLHGIFVRVHDHAA LREYVQKNTGTAICLRNPGTWFLVLRDGTEIPSVRGRRFDLDYLCCNEALQTVGILAVRS MGSEEKMLMETSSVLMLGATGAVYVYDWVTDALFEVAQNLEDFAEGGLIWYDSIYKHPAT PYSTVEPRYHVDRFLAADPKDANAMAAVAHELRGLNLAVVTPGENEREPLLLLGELSLLR KMKPFIAMSDEDFAEMCDVITKTLCCLWRLIGVAGYYLKVGAFVPAAVIICDRFGAIYAL KGEDGYICRLADDIQMFFRMGYLKLKGSYRYDRGCRGEARLECKPQCSHRYNRSGMEALA EYPMTEGEMEWYFDWLTRPTLKDEITFESPLGRTDLVPTGILTENQNWAFPCGSISTTPV SQDGAWQEKDLIATPFEDKRCFRAPRVFTTQCDDPDYEIEHDGDSRASEKSDLEKVPLSS SPPSPSPSKSSSLSTNNDKPRHPEVEKFESRNWEEEITTEKDAWTARVQRAQLMWKHECP TLRYRFPNEFQFPFGSSFM 559
17 Membrane protein A32 G8XUK6 MKGVNWGAIIVSVGLVACSYANTTSTQTSTTPVNVSSTTNVTATPNGTTPTTYNVSTNSS HNATVTTVTTVTTAIPTNRSHTLDPPTVDLLYNQTVNYSECVRNHTWLHRPQISYCDRYD TVWMVLGREDRTTPSGRKVPLAYEGACCVVDGKPDYVFFIRHWYGYVEHHNALRVDYNCS WHTRLTPLYPFTTNFSVLTENYMATMSRFKHGRPCKGERVYYYGLQHSDELFINDVGGVD IRLRNDSFVWPHDIHRRLSGPLYAPSESPPIMLYLSEFLVLCGLGAMFLYLLLKLLVEVR TSCCLFLRSKRTQSYGEPPRTKRPSSKRSKW 331
18 Membrane protein A31 G8XUK5 MTKLTTKLGDADKPTAKEHADPPEKVPMMPVPVGAKLIPAWEPVTRDGKPIFPSRWGTTV LMISEVPPPVQAQRWYARAMAAVPRVYTILCAMLLGSMFAGTLWLAVPFFSQFIAGNFPL GLGFTALSVLGLYILCSCQKTFTFDCFLLGYIAITKVTAISTVLCLYHTLVVVQGVVFTG FLFTVLTALSMFLRLNGKCVRWVLTVVLGMMVLSVLWLQRNVGDVSTMVVCGVMLVSYAV LVYDTRMLFVMGYGPREEDELICVGELYTSLMDAFLCVVYLWYRIVEANWPLETLTTVTP 300
19 Protein A30 G8XUK4 MSSLQRLTKAYRENFAPSCPSALNLICSFAWLMPGDSDSNSPDCIVTLESMPPPQREPED MAHYQHRTATLPRRTRFHLSFGVILTFFIVLAWTLIVAGLFWFLLSP 107
20 Membrane protein A29 G8XUK3 MAIRQALSKTASVAICVWVNVAFTWGMSRPGALPPHIVPKQRPLGPQRPQFVEYMHACQE SDGVWNTSAGRADNSALLPALMRLMLSDPSLNDNDKEILKITLCRNCAGNGGACDIARSD YKCIVSGKRMKAWFVFHGAFDKDPMVNDAVIHGTTGRSKSILRNVQARRLNKTAYAVTVD TEVKEYNAVYFSVNIMPCEWCVTEYVSCELVHRVSWSPFATYNILDAVRLFAEKRYLGFF WVYAIITTRVLLCLYVLADIGFTFNWFADHYDAILVAVIIVCLMIMWSLLRPVVWLRDVI LESMEINVL 309
21 Membrane protein A28 G8XUK2 MARRQVVITGVWVAMCVYMGARATVGDPLPMGTYGTHRFGDGPPLYTASQTPRQFGPKRP KFVEYVEACKNSHGEWNRLASNAYNNTLRPAMMRLMLADPSLQDRDKETLKTVQCHECAG GDDACHIGRVTYECPISNALMKATFVYRGMFEKDLMVESAFIHGPSGRTRNVLGHVRTRR LNASAYTVTASVDVTEVDATHFSVLVRPCEWCIGRYISCQMVTRVTWSPFAAHNLQDVVR LWGENRYAAFLWVYLLIIVRTTLCGTVLCDISKNVDWAKKCYSAVLICLIMLVSLSLVTW MFSVLCFLDVAYYILLMLEVNTL 323
22 Protein A27 G8XUK1 MLEFIKTAAMAIVGVPLVCTYVTGMAARALLSTGGRLRLTGSGDYRAKTIHVAQVPDKRN GKLRTVYRVQRWYLEKLLTAPADALQPLEKEVLSLLQTVINSQSEETQVVSKGDTVWLIV IRDRERESDEESGERQTRRANGVADWESMRQKQRERPDDEDESDLDEEALPWDLVWYPGE NDDAEGDMQEMQEMENIPQAPVAREEPDEEDSETESEAERRYNASRPANAEQYAVPVECG YESEDSDLVFSFYSSSELSSTSSSEDEGDDNNENHESEDDSDEVGEELSSSFSALSSVSS LESLPDLTSFSVSPAAPVMQVEVASVSVGAERLLESKVEGQCYEVSEGGYICINMSM 357
23 Tegument protein TRS1 G8XUM5 MAAPDAVCAPAGGRRELTEEQFRSLATAWAGAFLANTTPRAQRRWAQREQGALLPLGRPA GTHALVTPRAQMPGVGATDLRQMSPGDEWIVLVAVLVHRVPAAGQDRAHAARLEARAPWT ADGLCRADGLFLGLGARFRVFVFDLPRLTLHLAARDADEFFRYGLGDAAPLYACELLPRA TTRPARLAEALAGASRAAHAAHALAAAHAGARLELQTPGRAPQALRLCPDWAALADVWPF CAHRRPAELAEAARRFVTQRLCCAWYPLGVLELAAEAGEEGAAEGSAEGSEAAGGAAAGS AGGSAGSGRASGRDPGRALEPASEPASGPASGPASEPASPPAAAPAARARPLAARPPLRA AVAVLVDELCAVWAYCTLDGQVYPLADDLGHLLRAGTLALLSLGRAASSSEGEAAYRLLP PADLEFWETPRADALFLHPRAHHQLRDAAAQLAFLTRPGRWGPGAAAAGTGAAAGTGAAA AGTGAGAGDAGGSPAPQRGDDDGGRPGQGPGDDDARRCCLRDARALGLLPAAGGLPGGAL LPAAGLADALGGPLLPAAAAAAGSLPGSSLAAGSLPASSSSSSSPAAALAHALRHDAAAR RWRPQPIPGLPGLAGALLGDTLQLPRSGLASLDPVMATGGSPPCYIDAFSGSVLSAHAAA TVALTHSGAHATHLLYRDPDSHDYPRGNARIDEVAARRLAKARAAQGRTLLRPIPTWLIL LEPAEQPTTPATPSTGATNNSAKPPSDETRCQNGYTSSSCSSSGEDLPANNTAATPPKQE SPQGVHPENVCRCDHRRPEGQTLALAPLPAPRTAPAVSTLPPSAVSAALTWRQRAGQRVD VPRRDMQHGPPPYPHPPPRWQPPSHPAQFPQHPVTPNVVYPNPHPQQHLTQGMQRMALSL PGPPSRGYETYC 912
24 Tegument protein IRS1 G8XUK0 MAAPDAVCAPAGGRRELTEEQFRSLATAWAGAFLANTTPRAQRRWAQREQGALLPLGRPA GTHALVTPRAQMPGVGATDLRQMSPGDEWIVLVAVLVHRVPAAGQDRAHAARLEARAPWT ADGLCRADGLFLGLGARFRVFVFDLPRLTLHLAARDADEFFRYGLGDAAPLYACELLPRA TTRPARLAEALAGASRAAHAAHALAAAHAGARLELQTPGRAPQALRLCPDWAALADVWPF CAHRRPAELAEAARRFVTQRLCCAWYPLGVLELAAEAGEEGAAEGSAEGSEAAGGAAAGS AGGSAGSGRASGRDPGRALEPASEPASGPASGPASEPASPPAAAPAARARPLAARPPLRA AVAVLVDELCAVWAYCTLDGQVYPLADDLGHLLRAGTLALLSLGRAASSSEGEAAYRLLP PADLEFWETPRADALFLHPRAHHQLRDAAAQLAFLTRPGRWGPGAAAAGTGAAAGTGAAA AGTGAGAGDAGGSPAPQRGDDDGGRPGQGPGDDDARRCCLRDARALGLLPAAGGLPGGAL LPAAGLADALGGPLLPAAAAAAGSLPGSSLAAGSLPASSSSSSSPAAALAHALRHDAAAR RWRPQPGLGTLHGAGTAQAYQDPDVYEYPRGAARLDEVAARRLHKARAAQGRILLRPVPT WLILLEPAEPPPHRPLPRPQNTVYLDAETGENNCSSADTEEEGNCGDSGEISGEAGATSS SGDEQQPSAAADDGDSPYCTCACRGGPPLPAEPVETPRTAAPVPQHLPPQHHRYPPRQLP PRLIAATAAWRAAAVAAANSRPERPRVADPRDADEDDNGHRGAERRVNNANAAHNLSVGV RRMALSFPGPHYPYHP 856
25 Protein A26 G8XUJ9 MRTRWLWIWIYLSTVSPIRAEEASTSSYSWFVDVMVAWLEATVRWIGTVVGQEAEVNLTL TVTLNNDTGRPPAPPNVSHTVNAFNVSQAFNVSDWVTRIAEPTKTTFPVNVTDRRRNTST ASPTPRWRSALKKHAIPKTQANAQCEGNARWPHYVYRWDVQVPCPGLAPPCEDEAVWLTN IPEPKCVVGTRYLGARLENTVSGHRVTVWFRGGCCYVDGGWYPVILFEDAEGNTRHRNAL RVNHNHCKWPEMWWFTGNDVWVSTCQASRTYYYGLQRQSEIALVPGSDPELKLLDDTFAM LATNEWQIVIYEAVMFLFLLFVLIGVCVKRCQVQDWLGGEDMKIWSVETDKYFEK 355
26 Protein UL145 G8XUJ8 MPSRNFPQNTTHLLCQRPRDGPGRWERLIDHVSLIKNYTIATTLIAGTNSCYILLEREGA FAAFRQGLIPEKVRARLKHSEWIQGAWIVSETFPSENVKIYTPPKIYMPS 110
27 Membrane protein A25E G8XUJ7 MSTPLWLLTAGLTLLVSCLRYTGAVPYTCMAPGNHTTRAVTTADASKLPLHCVFSYIVGA TIGFNIYPEGRRNSQPLFLRYKISPNISVAVDNVTSVFSNISVTTIGNSTVTLTLHTNLT GCFDCIFHHEPWEFIQVGVGIWENTNPSSTLRGKNVTLFTCARKPYSHQGVTSVYSTPDR FGLSLKSIATVCHDDNETTTVYNVTVERCFCDYMSILCMDAVGNFWIPNTLNRYGEPPSC ISNRSIIPHPNKTSTVFNFSIVAATMLTPVFTPEIMGLITQKGPFPVLAIVSDVLTTLLI LWLLFTLRGAIAEHRDDRLPNKLYYHAQRAVRLSYDTKCLLPHRHVVSPSYINTPRLSFH IREPWRVY 368
28 Membrane protein A25D G8XUJ6 MARVLMLVTGILFSLCLAKAQNTTYLCAAAGHRTTNELFIGDNETIPLTCVFPRITGAVF GVYFYLEPEWPYTVLYNISQSNISVAANNATANIANTTITLNTTMNDTMVTLTLNNVTVE GIFDCLFSYNAQEFIRGGFQYFTLNDVLHKPARNKTFVYACALEAYSWRGVSAVEPLKWD FTQEVAVQTCTDDGENTTTYNVSVGDNGGLCRAMSIYCLDTLGNFWRPDTLNHYGRPPQC MHNRSIVPRRNGSRVTWLDSDRRYTVEWVTPYRLSSPVPRTVIPTVTVTQVRQRGSFAGM TAVLDFTAIFLIILSLAVLRALISEHQTRHYPNKPVDAVRHAWLSTLGTRRKRHIYYRQL PPLYFYSQKPWLMY 374
29 Membrane protein A25C G8XUJ5 MAHVLTITVTVIFSPWPVTARSVSHLCAAVGNRTVDNPEAAVTELPPLSCIFPRVVGAIV GLHLYPDRQPWPRQPYSIMYHTTAANLSNVVNNATALANVSIVLTMQIDTIVLAFETKVT GTFDCVFNREPKEFIKVSLDYTRLPLMVGISGPNRVYAYACARKCHSHQGVTYTGPLPRP IHRLLLTTTCQDDNETVTVQDASFHELGRFCKQMSILCLDAVGNIWIPQTLRRYGRPPQC VRNRTIVPRSDLSMGSWPRRYKPASSGVTRDRASASTVTRVRQRGHYTVFTAVLNMITVS GIVLLLIIFKITIVQHTHRHSSSWRHRLPGKNSISRLKRSHDGTRNSQHFPIKRHKS 357
30 Membrane protein A25B G8XUJ4 MAYALLFSAAVFLSPWIATVRAISNICGFVGEPHDPETILSNNSTSLSCIFSTRALDVVI GVNLHPRSNTSQPHSIWYHFSGNENITLIHDNATRYLGNLSVDIQTLTNLTVRLSMEMHI GIERSECVLHNQHWEKIRINTHLRREAHFLHYSLICATESHSHRGVSMLYDLSLQHVRGS SVCQDGNRTVQFLNTHLPWEGELCPLYAKALCLDAIGNVWMPRTDYRNGTPPSCVKERRI AWHRFLTYPMYRVHTPQLIPSVPYGMLLAIQVVDIATTCIIIACLIVLRRTISGHLPPQQ TKTTLVFVKPNTFTIFIR 318
31 Chemokine vCXCL13 G8XUJ2 MLLYRWKQMCTFAILLLTTANNADNCTCTRGKQIKRQQLQSIIKQVKLLQPINANNECKH RQVITTLLNNTVVCLDPDSNYVRGVLQKLLIHVKVKKGKIVVAERTKVDFPGWEVSKLFK KIKIIKKTGYTIKRLLPKPTVKPRAPRSIAKKTYSH 156
32 Membrane protein A25A G8XUJ3 MAGWWVCMVVMAFSSRSAALPDISNICAFTANSSKMEIPFAVTTSLTCLFPYTVNSVFGI QLAPWIGSAVRRSLLYRVFSRDGIVPVTQSWPLHPSLAIEVTQNATTILMTVRFPSSSVM GNALYCTFYNLPWEAISIEVKIAKHHMDGRFLCAEHAYSRFGVSSVEPMRPESQPWSWET CHDGNETTRVKTLRLFTSCCKLCSMIPALCLDSAGNIWQPEAGHVHGRPPACVANRSIVP YPLPTTHTVPVIPQTTSSPNVITVIQINPRRDLYTKISGMLSLFGSSVTVFLLIILRNII EKVTICHATTLIPCYVVTFR 320
33 Chemokine vCXCL12 G8XUJ1 MRITVVTWYVTILSCVLLTAAMAAVSPNELRCRCKPGQNYEGLELQHIMIVAVYPHNPYC NWQDTIAYLYGKKAWTCFDFSKLKTEIEKNMVSKTTREGITVYRRHFKETGIQVSESSQS LPTATVLGMPQPPVYFSSNASHATCQMQHNGESCSCSCT 159
34 Membrane protein A24 G8XUJ0 MFWVLMIWPCVSTVSFRCLGAATFSNISLTRHFSACYVDDVLLFRKDYSKHDRTIHPAIN SSTIRTLEDEIKYADEIYGTSYLLNVKTFNRPTGIQFQYGCNDAFGMYYEASRDATWFLS LNVSTLTWKTDNNVFPVVLDQGVAIKIRQHLLGCVHHLNTYYTLLNNSLTPKSPHLRLCQ YSDRAVCLAYNFYPQRINLTVFPGEDYDRSNQNTYPISTNEHQPRYAACMSLYTPTETEE GTINVTCYANHTTGRYMKWHVTQTKKSNYSVPEDIKYDDEDYANIDGNSNAGFGAGTNDN TDADSYTGRSMHYDGSATGTGTKPKVRVTPTSRSRGRNKARTRDKDRTNSKNTTFQLLSN SRHYGYTVIPPMILLLFLTLVTLWQRYSHHVNVSAFRLVPR 401
35 Membrane protein A23 G8XUI9 MVTSSTAYHTGLHALILYSSLLSLTVVGFRSPFAVTVTTIPAYVFSYLASFDYSEASGSS TINTTTESTTSLTTHAVTSEANSSKSTFTSSTLIITKTNPTVTSGTTPNTTTNANTEDFT STSGNTTKITGSATSTDAVNVTEATSITTATPAPTSAKGTSTLATTSVSTNVSLTSVAVT SASPCTSAADGNNSTSTANSTNTTTLNSSTSESLSLTVSTNISATNSADTTSYPSTSNSQ TTRNESVSANTTQPTSNVSDTNTMNPVSTTECNGTRNTILVSNVTSSSTTVGSTSSPGTT NSSDAATATTNATVTINSSTTAAKVSSTGTNVFSTTTVISTVTANSNSTSISATMSTNTT ERNSTVVSTTLSSTTNFNTTLFTITSPGTNTSLPIVTATVKSMSKSSLTPTSTRSLSINT TTPTSQPTNANNTAANGKHTTVCATIPPNATLLVTVVALGEGSVAKFRKPGYYIGFFLTL IIVIIIILFFCRHNIERCFQAYRYRYHQHDFAPSRYDDPDVLVMEMKEL 529
36 Membrane protein A22B G8XUI8 MKTLLVICLLESCVIYRGYALLDPCATARYYVGKIKTMSLSTTVSTDGSLLEAGWMHCRV GPMNQCMQIRRLSSRDHVDNTLLNNITVGGVTCPAVRTRLKNTTFHIDHWRGRRNNEVDG SFSVSPGSTLMHHYVTRTAKITLSLSALPGNVGYYTLYAIVDPHAVNPRSGRSYLPINEY ESFLLFLQTYGEGQCHPDAFVGKIFTRNITLSSNLEARFNVKSNSFGDHRFVWKGARAGA NKVFKTQHITMSVTAEQHMDEIAYSIEFRHPKEVPGRTTSIYYELADDGVEAADYYVKCV AQECQPATGCNQRLQIDGAPKVNSELATRLTPLSQQSVWSILLCAFEILFLLMFIVILSL VRYYRTR 367
37 Membrane protein A22A G8XUI7 MAGILFSVFIIQLSTALCATHGHGTPLVWSKLFSKNNQSPTLVKADGSVKTLDARFDSQQ PVIQVGWAYCTFGLETRCVDLWSVREEEGYRAHLAIFWLLGLPARQRICQALLTRLRNTT GNFVRNQNQRLTASLSLNASSSAPHQKTVTGNVRLQLPTNSRSAGRYYAYVVLGNDALDR GGLSSTYVVVKDFILLARVELDFHCYIDGMFSHYTHVNGTLQPCHLVVFSVITACDGDGK TFTWDSPTYGGEKNFTFVDLNVTVVAKRHKRDLVFGLDITHPKGQVMLVEYNFYCNQHLL ASQKLMCRPPDRERCQRNADWREIPGHLSTSLRPKRRQATSALEPWLWKWMVVFVLIYLY V 361
38 Membrane protein UL148 G8XUI6 MKPVLFLLLFIATVQLYHATHYSFPESEIEYEYAGTPLVSFALQFTAHGNAVIRAGWLMC NKTPTEDCVTLWNTSWGGDRCSSGAPKLSSTCPTEYCLSNVSVTFPWSEGNYPNVTYAST CFHRPHDLEGNVTLMLPGLTDNVRYYTAYLTVRANVPDHDGYFETRTYVKRFALMLHTQT GLECGCHEMIVHFLTFNTTLESGVSAMFAFKTSKTDAGEVIKLVDPQHNSTYLAYGDNRI RAVLLSVQNASNVIFQVTVLDVDNSKSMYVEYNLFKNQHHRAYRRVVCHPMQREHMAQQC GARSTATPGDDAKETDGAEESMKTEKKTEKAYTVTEDTNELRDTSQKTFLCLTTSEWFTF GVVTVILILMKYLPRDR 377
39 Envelope glycoprotein UL132 G8XUI5 MMTSTVATNITQAVNGTYCAVSVSLLEKLLTYAPYLIYFITGFSLLTLIIVTVSALYSSC KTRKDEYDPDIHEDELEDEEYSNLIKVPSRKSRFGKTTAVAKYQRLTEDYGGEEDGHKIS EAAAIIIYNENYKPSFSTGPSPCPSSTGPSPGHSTGPSPGPSTGPSRDPSPSPSPRPSSS LSSEKPGHCTVATIEPVLDTANGAIRYYTSNSEDFKQAHEAMSPFQPEVNDASSAYPCRI LVTHEIDLNEPEYD 254
40 Envelope protein UL131A G8XUI4 MRVCRFLLTLVCLGIVYVSCVWSVRGIISPTPGYTSFGYWDLFSPFIDNSTQRDIVHKLL NLTFPYHYGRLFGYSDIQLLRRINLTEVILLINALDIEKYTQTYDFDNVTVNVNGLSEIT PYNKSLLITLDVTFT 135
41 Envelope glycoprotein UL130 G8XUI3 MHSILVVTVMLRFAACVDLNCPSQPSPRTPVVYFVSHQPYTSLNCTPSLYALRTVSNKTL IVGDSAWTRQIINYVNGRNMLMFRLIRELVTQNNITQIPQHNDRTVFDRYFSNLIQMITV MQYQARDALAWISCILEIQTMAMEKYDDSNTIQFRLALQVRHAHAEQGFKSTICTHPYFS TLQYPSEYHDSFPFSIFMDIKPPR 204
42 Envelope protein UL128 G8XUI2 MTRFRFQYLWISSLLVNAIICALKYEETCCTHVSLRDPLEDCFDFKKCDKFTVSFTCRIG RVCLSPMNLSKVNDFILSMKDNLTKEVIHRHAPQCAHNPVHVRNEGDLRCAIPYSDLKNT PSRIIGLIDKLDTVWMPNMYSDIYMLDFNDYLLKLNATYNSTTNTVDTNVTCLQMIPPDS MPLTVHNKTLLP 192
43 Protein A12 G8XU85 MATAPDSSDIEVHAQEEDLERDIEQGRVSFRDLGEGEDSDLRRKYPKTVLLLLLVPLLLQ LIIMIVATCMNPEKVVIGAISIAVFVISGFITSFILCNALLYGRFFPSCFWSRLGATVL 119
44 Protein A11 G8XU84 MTSLLTQHATMPARDRSETESPFEHYVTNIHGRRRRHTLKLFSAIVLGPLGVQLLILITT IYLTNEVHIGVTALIVFCLSAVMDTILLQRMVP 93
45 Protein A10 G8XU83 MPVRSLSSIEIAPEDEDTLPSLHDIESGLVHVYQEDVAEHQDLQIRHPIRYLLLILVPIL MLITSFVIINWISKQDAIKALNVAVFCAVIVFYAGILINAVYYCMLATNRWVLLR 115
46 Protein A9 G8XU82 MAASNPPGVEEVALQSPQSPARETSRSQKRSDGSNIPTRYPKVYCLLITLPYWIQFGIMW VTFYIEQKSTALEALAVLIHCICTILTTIVVGDAILHGPC 100
47 Protein A8 G8XU81 MAEPGEPSEPGEPNTPLRNAEPQLDFQSPHQQGNEDTEPRNKCPVLLLMLLLLPLFIQIL AMIITFILSNQNPIAAGICSVMFLLSAISTAIIICNVLTYGYF 103
48 Protein A7 G8XU80 MAAYDNSGIEVHPLDNLRRSPDPEQREDTERQTEIVYEDDDFRIPYPRAALLIILCPFVV QLLILIATLIINRDVTVGIIAGLCFTFSSVATAYYVTRALLYDR 104
49 Protein A5 G8XU78 MILFNTMIPSSKPAVKPQAEQSTPSEPPPYSEKRDARRNIDDEVQALFLQMAVGIHFLPV FLQLCLFIVIVMTTRQSNQLVLIGGALLGFTVVASACSLIYFVKRVRPTNQQHNDTP 117
50 Protein A4 G8XU77 MAANDNVQLEAISSEEPPRPQNPEPQQQPQQPVLTWFENCTLCKRGTVPFCQSCVILQSL MLIGQLAMLIVSISLSQNLVIGLISGILFAIAVIAALIAVTSDLIYHSRFWPKGNESRRR ASPQAPADADISSTSLTESRQ 141
51 Protein A3 G8XU76 MASNDGEGIESTPLEETRQQDVEAQQKSNGKGKESCPHRCRRFMWLVLQIWMLVLQLLML ISTLILHENKFLSIFSGVLFSTSVLILIILLLRGYKPLPEIKLPCRKTATDTDKKATGAT EYQPCSPTEQSTEAL 135
52 Protein A2 G8XU75 MSQFIMSGSTSNGYTKLFNENDENEHDVHHNNDDNHDNHDTYDDSCEKQPLDDDDVALLL DELPPPPPPPMPAAMGPIHPLFEAKRLWARHVLNWLLMALMLLLLVLLLMLFVTLPEVSF RSPSTTLIVAISTAVATVSAVISVAIALAETTTRLFTHNPHIPANTAFGA 170
53 Membrane protein UL124 G8XUI1 MLNATTADNVTTSVTQTTNHSSTTVSTTILTSSQPTTTGRSSDRSHVLSFAHNAWMRPVS SIGAILCMFGLIITVMMCSFCSTDKNLEEAVQEIMEEAEALNRVPQDTIIDVPEMGKEDC VPALSITVPCE 131
54 Regulatory protein IE2 G8XUH9 MSDPKKFPGPASSPKRRHPQEEEDYEDPGEGTSSGTAAGPSTAPSLPKKLRPHEMNPVDA AAQFLRRAIQDEIETQMSLGDPLFSVSGAPSQFMDKFGIDILAEAASAAGLIDEATGSTP ITTSAVTSGVSSSSYSSSYSYYPHFEDTRTQARGPAPTAPPAALPTPAAPAAPTSPAPSE EHSPRKKPRKSAVPVKFTPQDEEDGWDRRPIKIEYSPRPMRPHPTSCCIVITDSSDDEAA AEAENEVGSEVQVQASQIAEAQESGAAQAEAQPSDTSDAAVRSVSGSISGSGSGSGYGAT PLTSSERVEHSDPRHPDVLEKPKTPEATSSSSSSSSSESEDSDSSSESKPSTPSTPVPKK RPQKKQQPSFEPLKVRSILKTKCTKFNVPATAAKRGRVKMGDIDRMFRATSRSLEYKHLP FKAAGIHEVLERVIAKCKTMNTTKSMMMIHYTRTYNVKSAVEEMRAKLGMLCNLSISTPF TFEHTAPKIHTPATVRNISQACENGVKGAWDVKEQHHHNLCPRSSDFRTIIVQAATPCDF LQAVKECLPLVYKFPKQVCIRTAECDDGGNLLPIYDECSSGYALGHFQTPAPQPELESLT QAIQKAIDDMDKH 613
55 Membrane protein UL121 G8XUH8 MWSVVFCIMIWHLTLAASSQVMHLCHFPNGEVRVTCMADVPWHAAYVYWTLGDRSRVTLT PQEAEIATRLATAHWYVRGRTHRSLLETRPQDNISFHVRLAAPDSNGQPDLTVCAVRAHH LVALPRCELDANVLGLYTMAIVFMISIVAAGALMKRSR 158
56 Membrane protein A21 G8XUH7 MLWILVVLTTARSTCKPDEYSTNNGECCPRCSPGYTVKTECSELTGTVCEPCPNGTYSLN GQLNCTACQTCKRTGMIVIKNCSTTHDALCACTTGYNCSQYINSSCTECVSNRYTSPQPG KIILGTSTTPPTYDKSTKNQVSGSKTASTVLWTTLVIVIVIIVICLGYRRQIHALVEDLL TSHGRIGTCRGHPGDGHAGVCC 202
57 Membrane glycoprotein UL119 G8XUH6 MMLYLLVVAGILPLALGRSNFSVTCSQHVDYNKHVMNTTCTLNYTGGAPDLMAVECFQRN LSSSAANTRVPVARMTSAGTNSTMRDVQIFYNNTEHALHVNSRSQYSLLYECDFLGPGTN VTSNWTFYGNPVASTYLQGVRNNSTLCVLVVNTQNLTVTLQADNLTIPPQHRGNKTENKH VSLQELCFPLNYTFHHVTLTLTSPGFNYNVTYTLVWLEDDIEYAALIYTVTLLMTLMLTL LAYVIYRCIYYMPVLKYHRLMTEEKSPPVEKADFIKV 277
58 Protein UL117 G8XUH5 MFSKVEIIRVREPIKLNSESLAPANKRKRNRAIVISPQTQGFVKIPPDNKNVNSVRIVGS RPARRPSPLQPPQPRHQQPRTYPYGTSLVRRRRIRPNGAQHLIQRYGHILEELARLLQMY DSTAVQLQVNSLCGNSFNQLKTAVLKLQNVTVLTGMQMATQCLPHDARAVSTFKHHERLG RFMDNVAPVLPRSSCYADTGLYQMCISGATRKDLVDATTLCISIIDQRPNVFNINIAKLS YPSLAGLHLGTYNEFSNTVVA 261
59 Protein UL116 G8XUH4 MKSLSWTWLLVACYTTAIIAATMSQTSTTNSTISSESASTRSTTGHNSSASSPSSPAMTT ANSTSQTASATTHPQSTVNIIVNATSRAPTSLVPGNVTVTPTHANATAPQSPSNVTGLPS TVSPEYICLNVSENIYYTADDENRFTKEKFDSDFSGSGDGDPNETVKANTFPLYIAAECS SNVTTNVTCNITRPNTTFSWTLVDSVNFYPRHCNHGIAVFLTQNVTWPANPVASSSFITR LYNLLQLQEVTQDIGTYLRQYSSDLTVF 268
60 Envelope glycoprotein L G8XUH3 MLLAAVLTLLTVTRADNECVTLVRQCISGESVLNTTLNGTNYDPLVKPTTDDGMLSQLIR YNQSTVSTVRGKINVDEQFIDQLALLHNNTKQLRVLLSLLQSDSAPLWMRAMSGYGSCGQ ESAIYTCYEDVCRGYDLSNLTYVNTIFTENVLGFEYLPSSRFSVLLVIRNEGSKLNRPIR IPVNMRTGLSLFYAVYNAVKGFFAENQLQSPLIDRLDKYYHDLDEAYKLPKTNVPRVRYG AETVDAQKHSRQPAVVVKS 259
61 Uracil-DNA glycosylase G8XUH2 MALKQWMLKNIPDNQPSSLSHEDQSKVMGIHQAWIVFLDLFEHEVALLREVMDTVNAARQ HDTIYPPPEHVHRWSYLLDDPHAVRVVILGQDPYPDGSACGLAFGTLPGRAAPPSLLNVY RELSRTNANFRAPSHGCLDAWCRHGVLLLNTVFTVVRGKPGSHRHLGWQQLSERIIRRLS THREHLVFMLWGVDAQSREYLIDKNKHLILKSCHPSPRNTQKSFVGNDHFKLANEYLHEH GRGTIDWSL 249
62 Protein UL112 G8XUH1 MGDQADSLRKYITFHNSTRVLHQNVNQTLDVRQFVFDGARVVECVNGEGHVRTLGKGWLC ATMVQTGEPSVSSSKAQQGFMSIDITEDNQLRESLFLRGGVVFNKSVSSVVGNGSPDAAL LTMICEGGNLQVTFVKHVTGRSSSAASVSASASDHGGHSGERKGGSGGSNEEERRKRPAP PVDANGAFVSRDPRLVGSRPKEKKRSQEGEGSPRGDKRPKTHHEPRNECEPRAHPEPPNT TDAVAFLNYGQLADPVSDGALPAVEHETAGVVVGAVMEEEENSGESRSSATTEDREETED VGPSGLGEAAVTHDTGDGGDDVTASEVSNSVPPPNPQEPEHHSPRFDDIIKSLKKLFEDC KDKRLCPNVPKIPLVSRPPPDEDGEVPGPSSEAGSSLDALAVSCAPPSVLTAATTVEALT SMSFTVPSTSVFSMPPRPPSRPVCEIKPNVRPPTPAEEPPRRSRSRGGRSGNRTRRDGQP RQPRQPRQPRRRRDRVIRDIDPDWRPPSFLEDGLEIVDFDEAAIAAAALEGLF 533
63 Interleukin-10 G8XUH0 MQGLQLLRGLLCCGVFAAASSRSPKNKPSIDCNPQTGDFVNMLKSMRQDYSRIRDTLHDR DKLHSSLLTGALLDEMMGYSGCRTTLLLMEHYLDTWYPAAYRHHLYDNQTLVVVDRMGST LVALLKAMVQCPMLACGAPSPAMDKMLQQEAKMKKYTGVYKGISETDLLLGYLELYMMKF KR 182
64 DNA replication helicase G8XUG9 MSIMGTEDADSAFRSRRYEDSLILNLSSAAKIERIVDQVKSLAGCRFEPEDLPPQWYRSI SRSIRPEELGGGGSGGNNGQHRNGNGANGNDGYRRNGNGVSWNSVGATATATNSGTEDVR VPCVDQIPFLPFRVLLITGTAGAGKTSSIQVLAANLDCVVTGTTVIAAQNLSSVLNRTRA AQIKTIYRAFGFNSKHVHLSDGAGTFYQRYRVCEPSEEDTIHKLQLNDLVGYWPVIADIV DRHLNMVDKKANLDGISELCESNIIVIDECGVLLRHMLQVVVFFYYFYNAIAETRLYRER RIPCLVCVGSPTQTEALESRYDHHRQNKNVQRGVDVLSALICNKVLMEYCDIARNWIMFI NNKRCTDLDFGDLLKYMEFGIPLKEEHVGYVDRFVRPPNLIRNPSYASDMTRLFLSHAEV QAYFKRLHDQIRVSERHRLFDLPVYCVVNNRNYEELCELTDPLSEPPRIEAWFRSNLARI INYSQFVDHNLSSEITTEVLQSAAAAAAAQTVGEGGGEEDLGAGDESGDGSYPETLLTLH ITYIKGSSIGVNSKVKACVVGYHGTFESFIEILRKDTFIERTPCEQAGYAYSLISGLLFS AMYLFYTSKHTTEDVLREISRIQLPDIPALCGQVDEATYNAFEDEGGSSSCSAGEEVHDI PCLSSENAWPEDENELSDHDLLAVDTFADPFFLKYTKPPLTGMLSFEETVYIYTTFRDIF LQRYQIMMRRTGGEFAKCTMIAYNRRNVITKENCQIVSQTGSFVGMLSSVSPAQTYTLEG FTNDNVLSLPGDRHRIHPTVTARGLSRLVVRDALGFIYVLDVNVSRFVESAHGKSLHICT TVDYGITSRTAMTIAKSQGLSLEKVAIDFGDRPSNLKMSHIYVAMSRVTDPEQLIMNVNP MRLAYERNALITPYICRALKDPRTTLIF 928
65 Portal protein G8XUG8 MDLYHWGGRSSGSKRQPANDLTWSTIRSILAADERLRISESSYLRERNALSASSVPIIDI FPTSRTLSYVKFLHGFVGNCRGKSIHQILRDPCVLRKQLLYGLSKTIFNTVTVKQVADEW RKHAQMFPYRAVNPEDLDHYLELWATSVAQSVRTGVLGAIRDILYRYADDDNYGLYIDWW VTLGLIPLQMIKQSPRDEQEQEQFVRAAVHKATDTHPLALELLDRNLPLLLRVVRSLCSV SVANSADVYIYKRGEPGRIEAKLKQRSLEVKIMAEPLAYERNRLLYTTPVAHLYEEIIRY DSLCRHQKVCQLLNTFPVKAITASRHEMNCKKIIDMMERHDKAGDAKKAIMKFLLNVSDS KSRIGIEDSVESFLQDLTPSLVDQNRLLPSRATQTGGTSNAGSSGASAAAERDIRDLFKK QMIKCLEEQIQSQVDEIQDLRLINQSWEQHVRELKSLLSRQEQQHRTSVTLMPDAELNHL SIIDAVKKAQEVSFCPFSVDDNRSVANSFFSQFVPHTEQLESLLSDLWLNEYFRTFRLRR TVTAQGAEEAILYSNYTVERVVVPYLFSILSLSSLEPIPEAYIDLSFSEILAAAYDESKL TQYVQFVCNREKARQEHVEKWLARPTPTLSGSVPQRATARPENGGADDPRRAGGPLRGQR YGLLHAT 667
66 Cytoplasmic envelopment protein 1 G8XUG7 MEALMIRGVLEVHCEDNVTVFCMQPEVMDITHQNNKLWVHTDHGTVVSMNEYHAECKCRS SWLGYSAVFLLENEDALSRVKLSAIRLKHRTAVLVPSTLKQFSLCVILSCVENVPLTRRC LQELLAYVQGLQATDRIDSMLQSSCRRLICSALYLFFDHPAEEIKPYVPKIFVLYMETRT SYVETIARLFLRLASLKDDEKTTLCLLNRLTLDEVPVSTALHDVLNESYPHFYKHFMDSP SLPIQGPYYYV 251
67 DNA helicase/primase complex-associDNA helicase/primase complex-associated protein, HEPA (Primase-associated factor) G8XUG6 METQSLQGLLGASCHLGLYGVVDGVPVMRCLFLELRASAEPQLRSLLLQGERLRDPEARE LARSTYTSLAAGATDADERRAALGRRSALMAQTLASSAVARVLARLFVPVRVWLDSQAVE VVAAESVPSAQHRRRLEEALSLYHVAKMVVIGSYPTERDYATTSSAAKNAVADDPRATAT EYVTHANKKLKRGYYASEMAMSFRVGSRKRVLEQSQDAHDALACLKDLFQVRDVRFLRSQ LRLVTPRGFLAVAVTDEQCFVLLRTAWRWIYDVLIGAFSGIRPLFDYLGPDLYDQGGPRS VFFPGFPGLLVYAVTGLSTLLRETAFDAVGEAVSLCGLPDVVGPAGKLPVRLRSERPARI TPEELIVFYGNVDGRPLLRTNGTSFVVRSRDDLECSVHLRPGAALHRFTLHGLVEAVMAR CVREEDFDAALPYTHRVSREEVCLRFLENLRHRAMETFIYVQGLLGYISQHLTSACASAG LEWVMVKNHREIYAYDNEAAPVAAVHAELCVRTVLQCYWKKLFGDAAADEPRCVKTDTLP GVLVLLQDEPRPRIVGAFETPSRDQTWLDVVGRVLARVPRLTPSSAVSELRDLYRDLLFQ FVSHRNEVSFWVTTCYPGDVVRAHAGVIDCAPFPGVWSEQGEVLVQSRDAALEADVGYGR YLRRAFAILSVCVLLHLERQQGAAAVSPAKGQLGSEDDDEAASPKGSPRLSEDVVGRVEN TVLSNGLRFFQLNN 734
68 Envelope glycoprotein M, gM G8XUG5 MASSHVDTINTKTWSISIICMILTFVNVTVHLIAMNFPGLGYPCIYNHIIDFQQLNLSDY NVMHEFTPQIFMDQLQITIYVIFMQFVFLSVAIYYLVCWVKICLRKEQGINLNQWSRDIQ YMGDSASCFIFILCMDTFQLFTLTLSFRLPSMIAFMCFLHYVCMLAFTVTLITQYQSLKQ SKFLLARIHPALSGTVQLKTVIVNLVQIATGFGTMVVAVSLGLGFGNNFFVAVGNMVIFV FALFAVFSIISYVIIEAVLYRYMKVLFGYYLGTLCGLLGLVYPILKYEKLYASNYAQQIN IGLGVLFFVWAIFTLLRIIRFFRRASRSYKQLAPIDEIAALKSSPATDDDDI 352
69 Cytoplasmic envelopment protein 3 G8XUG4 MGAECCKRIRCELCPQASNTLTDVLGRRVDLGPYDVLSSSEGEGEEEDDEKDDSIDGDDD SVTRSPGHLKKPKGGGSGYMPPTVQITAKCTRGSGKDKKTLLRAPTPKPKRKGVRFI 117
70 Alkaline nuclease, EC 3.1.-.- G8XUG3 MDEDQLAKVLAVLDDEPLSMFLMNSFLLHQDGMHNIPFNVLRLVYFYHVFVKVRRVHDFP LAEEFVSRVAALTRDELLRDILANRHAEAQDELREALDSLASSDYEVTAYVWLSRLFCLV PHYRQIELYQILEKESRGQADSVVWHAIRTDTVSATRFFEAFVGGNVAMAMDARKPWSTP AMTFGFHHEGIVKTLVEFHVMHGREPVRDGLGLLIDPTSGLLGASVDLCFGVSKHSETGT LAIHPAARVYEIKCRYKYLRKKEDPFVQNVLQRHDAEAVVQFIVSHPIPGVEYRPDCETP SAKECLVSHDTLFRHTLKRYRPVKAPEALRYHLDDLLYLNKGQTSEVIVFDAKVLRDETI NAEDAVSGGGGGSGETPQSYADSGWGPESEESTPELFNRLDVFEVSRFSLPAFVNPRHHY YFQTLIQQYVLSQYYIKKHPDPERIDCRDLPSVSLVSAIFRERDSDELGKELCVGGRVFH CEHVPLFIIVTPVVLDPRFTRHAVSTVLENWSRDLSRRTSLPIWVPNAANEYVVSSVPRP PTP 543
71 Tegument serine/threonine protein kinase, EC 2.7.11.1 G8XUG2 MSSSDDEMPQSPAVPSGAQGESVPLCPAAPKKKNARKRRRLAKGVRSSVKRALRFTSGAT QSTPADVDMNRVTGSGRSPESSSPTESFLRCYERLEDSVPLSEDSNCPICCRRERGLRSS SSMTRALLTAVDESDDGEREDDEDSSPGGCGHTYSNEHHIVTPLRNLRCDPTLFYGLHGP REHSTTLNSPYVLVYAPKAADFCDTVCRAVDLGDEDHRLGQGSFGEIWPLDESRVIKIAK KHSETILTVWLSGVARYRAGGPEREDGVYRSLLTATGACLLHNVTVLSRFQTDMYHHDVW TLEAIPSYRAAFHSLADAVRFLNHDCDVSHLDITPMNVLIDVSPQKPGEIVRVALCDYSL CEMHPTCGRRGAVVFQETQTARPLPACMHRLRECYHPAFRPVPLQKLVTLNPHARFPVGS PQRFCAAEMVALANVLLFCLARVLDRRGLEAVRRGPEHMLFQHAAVACRALDAGDVTACS GACLMILAAQLSYLSYLLGDVAAPTICRLHRFVESRFDDQQVAAFQKYCQECSRVMDYGS IRKNLDKLLNTAHGLYLYDVVRRAARFTSIDDLDCDCRTIFPE 583
72 Tegument protein UL14 G8XUG1 MTSTDKELLKEAMKAELEKRQHQFLRRSYGEQHHLTHHQALKVMSAAAGAEHRRGALVVR EISNSLLRQRQRLQQDLARARELQNSQVDAALDCLTEFKDAVDDSYSAFVDSVSSTCSVD LEEPTGVGRGAR 132
73 Protein UL95 G8XUG0 MSSDAASATTATTASSVATMDAAGRSRVAVATAPAATTGASPSVSTALCSVERLVELSAR GGEQAALGASEVLKFDEAVEMALVACEAASPHDRYRLIETPNENFLLVTNVIPKDTVAPR SEPIATGLTAATRMTSSAVCGRHAVSRNAVQLARNGVGRHVMSRGDVARNDVDGERGSTA NGDLLGRLYEGALSPSVSPGRDYVLRNARQTLGYRGQLVYGSYLMYHKEHLELALSLNKA SYVESVLRDVYAPGLLEHHNVCDAEGLLWMLYSGPRSFCSRDACFGREQAGYHMPFPALL PALFYEPVLDYVTYMNLAELYVYVWYRGYEFTSTADELRLSLNSVTLDRLQEVLKAVQAR FSGREVPCWPASSRTCVFCALYSQNRLCLDVARNGVGAVFYSPILLQDCPAAVTDVTLSH VLPGQGTVTLFPVYHIGKLLDAVRYSENGVARLELS 456
74 Cytoplasmic envelopment protein 2 G8XUF9 MASTSVCCTRDLRLLRGFVQNECVWRQVSKTPKSREYVSVACKSATFDPGNGQDNSCMFC RLLLLSRGGQHVFCMAVNGALMGSFTCGRLRRVKYAVAGLDTFYHLQMSEPPCPIVLGFA PSFAPASSTVSTHSLTPDFIYDFCTIVTQEEAKSIVVRGGGEPGTRRAIKLGGPGTWAVK HQTGMDLYFFLLAYDLYTTCTGKHLLPSMAKLMAISTACGEMSCPFCKDHGTHVDPTGRY VGLVPDRGLCFCYAPCRTPTAPITNEEYVPFFCDDANSATHMSVTSAVRQHGLVTLASSL ESHIAVYSGSGVPLPLKRACWQLVKLAHPVSSLIVRSCPVVKSVVI 346
75 Protein UL92 G8XUF7 MANAATPDGRGCSPCDAVGGCEMRQVRNALTEEIQLHCLYVCVNCYKTHVCDLSGGCVLV ATVEGSVCLKTGLVYESLCPATRVHVLEPTGETSVDDVNVVGVIMSSVYSYLMAHATRYA DVIQEVVADGHLKKQVEDAVYFTFNRVFRSLQNVQRISVPVISQLFTQLIIGIHAKNTKY DSSVIKVSRRKREDALLKQMRFEYGNAPVFGS 212
76 Protein UL91 G8XUF6 MNSLLAELNRLGVAHDMSEDLFGFADTLFRRFSFVFQDQESDPRKVDLLSSLFEHLTIEC VNEILDLCADSEAAAEGEAAGLGGPEAAGAAAAAAGSVTTGTAETTFPASQ 111
77 Tripartite terminase subunit 3, EC 3.1.-.- (Terminase large subunit) G8XUF5 MLRGESLTRIQRRYEEFKKKKKSPASYISTCFPNVAALYRKRFQIMHPELGLAHACNETF LPLVTFCGRYRDYNSSADEKRPHLMFSETLKTAIDKVNFCPCPEDQRGCYQKIDALTELY RDPQFTQINNFMIDFKKWLDGGFPSAEQENTRIHLEPFQKNLLIHVIFFIAVTKLPVLAN RVLQYLVHAFEIDFLSQPSIDIFKQKATVFLVPRRHGKTWFIIPVISFLLKHIIGISIGY VAHQKHVSQFVLKEVEFRCRYTFATDYAIENKDNVISVDHQSAKSTALFASCYNTNSIRG QNFNLLLVDEAHFIKKEAFNTILGFLAQNTTKIIFISSTNTTSDATCFLTRLNNAPFDML NVVSYVCEEHLHCFNEKGDATACPCYRLHKPTFISLNSQVRRTANMFMPGSFMDEIIGGT NKIVESSALITDQSREEFDIFRYSTLNKNAYEHFGKTIYVYLDPAFTANRHASGTGIAAI GTYRNQFIIYGLEHFFLKDLSESSETAIAECAAHMLISVLSLHPFIQEVRVAVEGNSNQA AAVRIAFLIKQNVLSSHLIPVLFYHTPDQTGIEQPFFLMGRDKRLAVEEFIAKFNSGYVK ASQELVSYTIKLSHDPVEYLLEQIRNIHRVTLTELNSTYSAKKNRQSDDLIIAVIMSIYM CDDLRSFRFKLI 672
78 Protein UL87 G8XUF3 MASSDLTRSGGSECALIVESSRERSALGVLNVPVHVNSHNLTQELSVEEDARFARSAPVN AERVRTVFRALYAAGPNHVNGERDRTKIVLCRLLLGPVAVPCYCDEWDTNEYMAEHSRFC AGPLLYVHRQCRCRGGTAVSGQRLAFSVMKGHQSTHVFRGLLSLSEWNVHLPRMFCSCLS FTSDRYVMACLPGSMSLHLDDYPYLMGEIGSVLNIAEIDECVQAMVQHLGQHVSNRVQIH YKLLFGVHIRPKAPLARSGTEHFFALELQKLWLSVEYHNETTFEFFERIFHQFHVQRAQT MLALRTPEQTPCALNAFSLSRFKRQVLYFKIAVTYGKHRLGMGRNVIRYRRLHIMFSEAD AIWRNLFFIYYEQQQQPPPQQQPALRSDAESAPSVPSAQSRVHVAPCQNAVNAGATTSAV VSKNSVQVRCGGTGVCGGVPGGHSAAATPGPPKTVVPTTSSRLARQAVSATDLCRRRYIC IVTRLLFARYRRRNGAMLDFTGASWSAAYTAHVREARRATQRYAMQLRKLIGGREFSEVT SVTLDRIAVNAFNTNRVINMKATLSTRPRPGGRQFPRNMTHSFVMYKHTFKEPACTVSTF VSNDAVYTNSLNVNIRGSYLEFLYALGVYRLYVNIDHFFLPAAVCNSNSSLDVHGLEDQA VIRSERSKVYWTTNFPCMISNTDNVNVGWFKAATAIVPRVFGSDLEGIMLKELTCIREMG DVCIDYGLHRVFTELEFRNSYQIPFLSKQLILFIRGCLLKLHGVGKRVYLDRFMFEAIKS GLFDYSKNTTGHTKIKHTCALIGSRLANNIPKILIRNKKIKLDHLGRNANVLTVCRHVEP GRTSAGRLKTLLDVLGALYAVSSAPHTRSVIRQTVARLGGRLEDASD 887
79 Major capsid protein, MCP G8XUF2 MEENWNALELLPKLGLSTEFLMHVKTSATEEMYDNLRLYYGDDPERYNIHFEAIFGTFYN RIQWVTFLSTSLAIAAHAIRFDDLNKMTTGRMLFHVQVPRVASGAGMPTSRQTTIMVTRF SEKSPITISFELSAACLTHLKETFEETILDQVLNVEAIHTVLRVLKNTSDAMERGLVNMF AQALLNKAPPYFIVQTLLEHATLCRQSLNRVQRANIVQSFKDKFVSSVFLLNRSRDRDVI ARFLTQMVEAATDSILDNPNLYTTSGGERIAGVIVSTASVIQTLLSSLGKLITKETVTAP ASYGNFVLSRENAVTAIAHHAIMADFNQYTAHLATDKQDELSNTAIHNSATKQTTQLQMD LIRLGEHLVAIEHLRRVYKNTETPDPLERHINLTFFFPLGIYIPEERGYSTAENRIKLTE SMQNTLPTIVYFLDRNRHIQKIEYSDTLKTLCHPTVYDPAACLQAFIDNGPRDDRALCQR QFQHENMGGIARRCIHFYRVRREVHPTTNEVKQNYQAHEFFKTTNPTLHTELHPFYDFTH YTHNGDTAAMCTPRIMLGNLPVGLAPAGFQELRGRQALESTQARPPPDYENTIAILTRTL TSSNYPELFYLVDALVHGNQDAFLVIRAFVARCIINTYNTRGLLAFGHSFPLIKFIAEHL ADGIIPSEVHQHYRNTVTLTRFLARVAALATSNTKLVDEPLEFYLSALHDPRLFPPFLTH LPNPREHIRIIADRQPLTTANIEHRHHGVSDVLRLAAMDADEPLFTDEDHISDEECTLQK TYYFCILPALTNNHACGIGLNLKTLLVDLFYREAFFPPSRDDRSEHREEIVAPAVQVGEM LNLLVRDIATSLNVNVLDACRELFLTLQYVPEHAKVLKVQTPLDPAQNHGMPTFLSYQYV LYNGICAITAPKVMAEYAIPIPFHRFFSDPGIASALSDDIKTFIDDFPHYHRNDGGFPLP TAFAQEYDHWHRSPFSKYSATCPQTLQSMVTLAAMHHKLSPVSIILQSKVNVHPGVALTF VRTDTFEADTLLYSAKSCTSLILNNPIVTKEERDISTTYHVLQNVNSIDMGLGYTSSTCL AKLQRVRSDMGPAIQDLFHVFPMSVHRDPEVDQWIRTTIGAERVQMLDTDTVAALTFGQV PMKNGVANLHGQRALCEVLLTPVTANINFFKVPNNPRGRASCSLGVDPYDEEATRHTLYN HQEQDARSFNATHNPWSSLFGSINDVLYNQQHRDRLGYNSRVYSPCSQFFHTEQIIGSNK TLFKTVNEYLLRAKDCLHGDTDMQYVCVEGTEQLIENPCRLLQEALPLMCATTQGLLENR MKNPGSYNESAETHFGNYAIGETIPLQQRIMYNS 1,354
80 Triplex capsid protein 2 G8XUF1 MDATVFCTFEHKLSVTDIAKLSRLVGAVVPIPQRHHLIKHHSLGLHQFVDKNRGYTRLRS LLRNMTLCMLRRVEGNQVVLNLMVHGQCYTVMNTGPVTWEKGDVLTVMPPLSGSTAGQPE TPASSPFALKIGNWDLVLPWVIPMSLAAEINQRLLVMALFSLDRSYDEVRAATQQLRTIT FRGVTFTIPEPTVDGHLLLDMKNACISMSMVANLASGLLTTYIRKLALEDSSMLLVKCQE LLMRMDRERPEGRLQHVAPDEEVNRLSALFVMIRQLSDLIHEQALFTVCDVSPDNKTATC IFKG 304
81 Protein UL84 G8XUF0 MSRPRKQLGKRLRRSQFSTMKAPADKILTLNEKYSVTRANPEGIYKLIQVNLDMRPDDLS QNFNILLSEHIRIEPDPAQPHQAIICAVSNTDSDLQAAFSIFPGSPGCKIIRSVLDNKLS RLAIVRLSLNVFALRVVKPLLDQLLVKQTPEQCNPTTLHDCVTLRADQFELEKSGERIIV RVTETVLCWHQIEGGIAGPRGLTSRIALHAPDLDLPHPIFSRLTSSTCPLTVSTLSQCAD GTLKFNVTTSQEDFETTKAVSFEIQLFQEVVQRPYFSGTPSPYFTPNGDDCLDVRLPYDL HIKQSFTLRLYRRFYGPYLGLFVPKPNLGVEMPVTVWLPKTWLEITLVGRRASLRRDDII GQLYFIASDYVTNRGRSSAFSHQVRSSLHLRSDHSCLSVLGTSIRLDDLLSLSVRPREDT TATTETSPDAKTTLAMVLQST 441
82 Tegument protein pp65 G8XUE9 METRQGRRRHEAGEYVQTIGPISGHILKAIFNGADTLIKPQEMKQLSTGIDVKVAVPAVI FASHFTPDSDRDHDRTGLTCQHTAFYSSEVKNLKVNVWNNSDRVQSTRKDPFSIYVYALP LSPVKINQLYLFAASASDKKKLSCPVPEADTTIQKIGFQWSVRLVVSKLVWTRGRNETSN FHTTCFVFDPLDIPIAQIDGGCDLVCSDDSCVITKLQLTRENKVKVYVESSKTEDPPSRL FCHILLQKYDADIVMNRNPKPGMRQHGMNGLAILAPNKIIVKPGKVSHVCLDATFRCPGD KNYIGLIVPKCLPGLGISSNFLHPGQHVFLELRVLGDGPVEIETGEELGNLHFVESSMIM HKSPGFYSFVDQYHVEAKLEYDHVWDQARESSGVEGSGPSHRGGPMAAGLAAAYAAGPAD DSDQDSSDDDYRAMKGECPRADTDDDSSDDDDERQPCQNAVLAWPCWKAGILTAHLPPIV AQATGPRLKPHRFFWSENQTYRIFFQLIGEWSTVLQAKRRRQTAGSEPSASSLTVVPSVK KRHRF 545
83 Capsid scaffold protein G8XUE7 MAHALPTAAAPAAVAPVAPAPGAVSLSSDCVYLPKDAFFSLIGMSAGKTGAAGGAVLDAG PQRMLGASPLQPAYPSAYSYPSPLPPGGYGDSRYGAYGYGPMVGRPYDARLEYGERGRYE YPMELSYPPYPQPVRGRFQGRKRKKGGSSSEEEEEEPSFPGDVDYGSKGRKRFKNDRHGG SGSSSGGHNCDAMECEHRHGRYEDLRDVLSELRRDLAATRNAMQQQQQTASMPPPAPVPT SSAASSSNEHAKASSEKAATHAASTSAAPPIVNASCVPSMSHHQAPTPAQQQHPQKERPQ NMVDFNRRLFVAALNKME 318
84 Capsid scaffolding protein (Protease precursor, pPR) [Cleaved into: Assemblin, EC 3.4.21.97 (Protease) ; Assembly protein (Capsid assembly protein) ] G8XUE6 MAPVYVGGFLVRYQERPEDDELVLPRQTVETWMRDENAEGIPLNVNHDDNAVVGRVLGFH NAPAGLFCLGCVDSPSFLDIVEKTADKSEVVSSGPGGELDPDPVLEFLSGSYSGLSLSSL KCSAPAVEGPGVEKESEGQDATPSEDSTAVGRYFKHVAICSVGRRRGTLAVYGRDVDWIL DRFPDLDEEARSSVRGRVRSELDKSQEPVDRFHSDSYGLLANSVDALYIRERLNKLKYDK KLLGLEGQRTYVKASESTSTPAVCDIKAPEVEPEAGECSASTMAHALPTAAAPAAVAPVA PAPGAVSLSSDCVYLPKDAFFSLIGMSAGKTGAAGGAVLDAGPQRMLGASPLQPAYPSAY SYPSPLPPGGYGDSRYGAYGYGPMVGRPYDARLEYGERGRYEYPMELSYPPYPQPVRGRF QGRKRKKGGSSSEEEEEEPSFPGDVDYGSKGRKRFKNDRHGGSGSSSGGHNCDAMECEHR HGRYEDLRDVLSELRRDLAATRNAMQQQQQTASMPPPAPVPTSSAASSSNEHAKASSEKA ATHAASTSAAPPIVNASCVPSMSHHQAPTPAQQQHPQKERPQNMVDFNRRLFVAALNKME 600
85 Protein UL79 G8XUE5 MEPSAETHVRTGRFSFTCTHNLIIQITTKLSSGQPLTAFQLEELKIIRMACLVLFHRGLE LLLLRETLNNLGVSDNTVLSRKAPLDYWFHLYRELRQLFPQLNLDRTFNEHEAARVSQQL ATAQPGSDVLLTRFIQRHTRLLMKLPRDLTSHGNILFSLGTLYGHRLFRLAAFFNHHWGT ESHEPLIRIICQKMWYFYLIATGKMLITPNALEIQRTRHENGVFNFIIDDYKTFTGTTQL TPHHRQPLQPSVISDTHKSLNVPDLKFRS 269
86 Envelope protein UL78 G8XUE4 MFGVQVELLFHGAMMGLLLAGAVLLIMIVGICFLAAKRGRVPYAVSIFVWNLFASQLLTA AAMLFTNGLVTNLPVSLSVCRSAMYLEDVGTCATSLLFLFLIMDRLSALVNGRAEWKHQS HQNVAAAAYAAFLGWFLALVVAISTQAVVDVSRRFPYTCEIPLGYSAFDMSVHVWFLLAA PLIIVLAYVLEICYGNQRDGVWPYIKTVWVFYALSAVFFVPYMALRVIRSLFGVPVDFPE ALDYVEIAFRALAALRVCVYPLCLLYLSTYTPMEEFDNAFAVSCPDVRGTLSRLLSMWRC FLLGRDEERRRLLGGEENGEHVGGSMPGCADNPAACTEDETVAEKMD 347
87 Nuclear protein UL24 G8XUE2 MSSPPEKSVSLSDLPRYRAIAGKRKHFAVYRQIVKTLNNFQRFNLALGGVFPPGLAQCRR SVFFEVTVGRRIPDCLVLFSSEGLVRKIVCYVFELKTTQSSADADSVRKHSSTHYLQYVQ GLRQLKDTVDDLRGFSSGAEGDVWDLIPVIVFYPQNEARPSFCRAFRVTTLRFRTESLVR VLCRGQDESVRNILSSARAQDRARSRARRRARVHSGGVRRARRECPVGPGACTSAPVRRY RYRAKKATR 249
88 Envelope glycoprotein H, gH G8XUE1 MRTGTWLSTCLGLVEVLLWTSQPCLASSYVVHVPAPVLKYLRETNITTCTNGTFRNTSSI REDVITFNFYNIDRLTNHFDNKIQTFQVPRCLFTGSVATELMDQIDLFESFEEYRRKLQH YATAPADFSYLYYAQPLTADIPKEQNPYKKNINMSDFYTLNLVPCTLFQGNEVIFTLQTP CVQQSFREGKNEINITFTLSFFAMQLRISNALPLLMIFGDLANVTFKAPFRKENFILRQT IEHDLIIILNRNALTTYSFIKDTDFPSALKTNYKNFTEINKAFNQLAVTGILQDTCKNIQ HNTVDTLMAYAILVYSTTNIQTVKHKDLRTAILRASALLEALDYVSTCLQLTSTSILLHN ASSTYRTLLQDTMWLRRETNALIYIAIKQNATFTVPEKAMSTLKENCLDIHSRHLASFIS KNNRKDLHHMATITHSMKQHTPQRRTIFIILTGLCSIAEFGHWSAIVMKGADLQLNDIYS PCAGGGRRDHTLEYIRKTFPVIIPQGYSLKTLVNVLQFFRSPLTQFSEISCLTAADVFTA LTTPKHTFIVGTGYLVAGTSFPVTTTVVGVDIVIAVVPNNGTCRKSTQMHETLHINTARN ITLTSQCDFCESALIEYHDSVGVINVLYLHDNDDLKFALEDKNKIFVKGSRTHYLMALRN GTVIDVTDVVFDIKDTSILIITLYVSAAILGLFIMYKIFRLC 702
89 Envelope glycoprotein 24 G8XUE0 KTETPFLEVCWVAFVNVIVLTAVCLLIYRCFIGFQNDIVTRTLEVVSMCQRNVSSCCREV 60
90 Envelope glycoprotein O G8XUD9 MKHKIIVTILIVIFLHYINSKPKKQSKQQKKPKPPFPLTFPSEAVPAGPFETNLTSYFWI KLGYSSQAMPPNYTYNITDKDKYLLVQYTPKITNNNASFQGLQVLTSPLANKPCGYMPSS GCFNEILNISVRNNTGEKYCELLTYNPMLYNVPRWNVQILLPPNTTYYTDSQSIYFFGLT TLITKVALKKNCSNSFHLLNAMSNMFFRLKMENDSKITSLFRRVKRRLKSAPSSLNTTIY TLNHNSTNGTFLNGNISNPQIEKLTTLYADHLKTYAIWMYTDLTRRPWCEQQPQNYSLQI INDTAPDTPYGKLNMSTLYSPSPVNETKTGFNMTAELRHHLTELLKEYLDALVMRANAIG KQIQEQEELKKRKQQRTPTFHYRFSVLSSPSWWIW 395
91 Envelope glycoprotein N G8XUD8 MWFRQKFLLVALALALVLVQESRGNTTAAASSSSSTSNASSVSSVSSASSETSSALSTSK TTLSIVPTSPKATSKPTFYDVTCTSHTYELSMHSFAAIWMCVNVVILLCSFGVVLKHFCF QTFTISTTKGY 131
92 Deoxyuridine 5'-triphosphate nucleotidohydrolase, dUTPase, EC 3.6.1.23 (dUTP pyrophosphatase) G8XUD7 MMVSILTDRLSHHFILSSPRKSRLQPFFKTPLIKDETAQDDGEQQLFFNLRFCIRSISER TAIHYPLPASAREQTQRKIPYKWTPSSFFVKQHQTRLTFFNKHIVWLSEDRNTTLPLGVD VYIPTGHFAITFYRCLDLSFICMADLIESGLQTPKVQIVNLTDKFQAISPYAIEGDICVF PCLLPEPWQVINLPQPTDKRFFLVKLQAPVILEPGQVRTIFLDIAYLYPFGACALIFGTR HFNRTGVLIRPTIWLPGTVATVTVANISNNSVRLTTQAALVKIVFTSYHFAYLLVDTHPI GQIIVPPVPEVGFTHTPDSAFLKQLSASASASSSSASPSAATTAAASVPAPTTTTSSPVT VKPLSPLTVTALSTLATASASSPLRSSSSSNSPRSPQSPRPQRPPRSSRSRSSRSSPASA SPPTIILPSSSSSSSK 436
93 Tegument protein UL51 homolog G8XUD6 MECARRVCQMLLCMRKSDVRADYVLLKPSVDPDLQELQEFLHEHFDDLGVTSTDLANYTK DREVIGHLLKLMPIYKQCQNKCMFLKGYLSDQCRPHTRPSAEVECRKSQRILEALDVVML KLIIGEFTISDDESLEKLLDKFSADQATLCEVQRVMGLVDMDVEKSSSIMAAAAATSTCP EAAELSVIEEEDEEDAGDDEVVALMERSPSAPQQAPTEPRAKKKKGSQPEAVAVPGS 237
94 DNA primase, EC 2.7.7.- G8XUD5 MTLVLFATEYDAANIVTNILLKAASNHHIYPLIVKHKASRLIHFCLQTQKCHNSERIAPV FVCHTDRLDLMAHLNSRTPITTSKLIESLDEDETRLIYQHLFRTVTAPALGGEVREFKHL VYFHHTAVLRFLNQTFLAPTSPSWFISVFGHTEGLLVLTMSYYLFERQYSTIPTVEEYVR SFTPNTGQVIPTHTSMSEFMNLMLGSRFKIVVPQFVNYAIRRNQRDYVELTHVDTQINTF RDRARLPDAICVHYIYLAYRTALCKKRLLQYRKIVAYDPEAAEQCQTEPLFLGRHLVDDL LDVMNRYFSLHNFLSEYVEVQTMDTGTHPLRLSGYDIDTDGDSLIRFCGNMSTVVRTIER INSLTDSVFSPTERSLGGMLRICASTKPARRYVTPDEVEHTYQKQYLFPPQSRCDGPVPL YRVHLPGNKHLFCAVLQEAWSRTLFPGDFLRHIPDNCQLSDEALTDALWMHDDGIGDMRP DVQFYYTRHEIFNERLPVFNFVGDFDLRLRDGVTQLTKTDIFDLCRGLRRVFVTVWKTLF PEVEESCYPVYFFKSACRHLAHDVEPMMLMMEEHEDDPSPGSSQAYCHCTEKIGMRIITP FPPGTVVVQPTVLRAIGQILNHAICLDPALHQHLDAISHPENSLDTGIYHHGRSVRLPYM YKMDDHGYLMQCRLLPLFVLPDAFRSTPLSFVRAQLDLRNLLHHCAPRFPQFLRRDDEAD GSAAVRPGAKGAEVMEAETANSATAVSRVLVDVRDKLCPKPDSNFIDTRSLDVTRYRRRA FSEVLARHTGAGEATAETVRHLVHSCVWPPLLEHLVRHYPPEISEQFQQDEIAFDVSDLQ CVGVKKQQGQRLRDFRCLNRVHRNPQETVQVFIDLKPDRGYALWAVLWSRCFTSKCHSNS KNVHVSVKIKAPATPEA 917
95 mRNA export factor ICP27 homolog G8XUD4 MDYPRSRYGVSISGMDEGERRARRARRFALDYDEMPGKRARRETTPPRRYYHYYHYDAEP GGRSRTRVRRYGASALTGRSGVDLYRRRRTLAPIPAAEDVAASDDAAAAASAAAAAAAAG STVGASGSPSAPHAAPLSQLLDMEISSMNDEELDQLSALIEQRRRLQRQLKEEFPAAAEE TTSPSSTSPPYDLQRYTAESLGLVPYRDDVRKPVAFPDYHDNGRILLSHDELMQTDYIFD IRRQFDWLKPNLLQKLVVERTFSVANASSLHMLVAMVDETLSYIKYHYVHNLPVNPHDPY MSTVHSLRQLLFNKLSNVDLPCVMNERDWGPNCSLLKQLARKPVRATHMRDDTYDVQRRP ASDFDHPLHQAMSFVTSFARSVALLKRRSEQSNAPMFMERFDDNHAISAYRCGMIADLII GVFRRHECDNELCAMKLHKALQSYRLMLSFCPFDECCVLDLGPLLPEKANNQPAVKTTEI AVATDFVFAAPPAPAPPSVPVISIQAATSPASPESPHQCNVAVATTFFHDASTNTTGSWT PTPDPPVHEVAVGTVECQEHNSWNVSSTDIQMQTGSDSMTGLDLPDYDNILSYSDMDDDD Y 601
96 Major DNA-binding protein G8XUD3 MGDNELSAATPVGAAAYLYFMKKNAETEEILALLSLCSKKSPVVIAPLLVGLTADHDLAT SVRTPVVRYDGGVLTKVTSFCPFALYFHNTQSIRDFCEDPGNVEELCGDTRQKYGVESYR PDEARTPTDIEALCASVGLKAAEVTVHVVVGHGLKEFLYSGQLVPCLEECVAVRIRDGEG VRVPLYPSTLFDLAEEDREGDEVSLSTKNEFVLSRAFYSPDVSEVLFYYLYTSWGQALRF KDTTVLIEAALKQFVHDSQQSVKLTPHKKYYGYTSQKLSSLEKDHLMLSDAVICELGFSF MSVFFDSAYSSSPLMVFSDWPVVVDAKDHAELMKSLVDLKLHLSTHVGALIFSGNSILYQ NRLVYFAPSKPTAGGAGASAQDVLLRAIQFSNGLVALCEDAYNDSRRLIKYEGVICKEDR FSPCHLALVCGTCPQLFSSLIWYLNRVSMYNTGGNGVNVLHNHIVACSSNMCEACGGRCC HTCYGTAFVRVQSRLPLIPKQPKKEPYVVTMFSRFMNDVDILGSFGRRYNVESKEAPSEG KPDEAASSRMASSSVDRMYYVTKILEYCKKARLVDPVTGEDTLQLQSKSDLVSAISALNK FVDDQAMSFVSEVRMKSSRDEVVGSTQAFNLDLNPYALSFNPIFVYEYYRAVLAIIQNVA LITATSYIVDNPLTVSSVSRWVNQHFQSIYGAFSTASSRKGFLFVKDMKSSKTVDHDRLM DFAAYRHGRYSVMSMEVKLCRLSAYVLSMFRVKNRPISRASKGAPGHVFFRRDGTPKKNP AKGCLGFLLYKYHEKLFPECPLSCSQFWQRVCANAVSKSVDIGDMNEFNGFIKFLIGVTS DYGEHDLTDVQPDSILSYVENRFHNKFLSFYGFKDYITTLHGLSTRLTCQSHAQFPYLLG KTPRFDSVPQYVIHVKGLKSGNVVPAPRAATVARESLMRTVFEQRSLITVSFSIEKYAGT NNNNKEIFQFGQISYFVGSGVERSLNTSAMGGGDYKYMRHRFVLATKFADVLIRKVRRDN VLFDADLVKNRVMSALDSDNLDHDPELVAIAEIMSSREEVPERDDVLFFVDGAEALADSL MARFEVLQERNVVDFSLESLEEVFSAGAPAAAGGEGVYDLSGLFVNHVREAPHGLAAEPV GTSPLMDDEVIPAKRGRL 1,158
97 Tripartite terminase subunit 1 G8XUD2 MNLLQKLCVVCSKCNEYAMELECLKYCDPNILLAESSPFKRNAVAITRLYRRIYPELVKQ NHVQTSLLSLYMEVSLQALYEDTEILDRALKKYSQNLDRMEYYRTILRLDSCERHHVVEL KFTDGVKCSVQLGTLNEVERFLCKMNCVYAMLSPEHGLEVCSQLLRLLRCLCGISPVACP EVYADEVTCAHCYEELTVVPNQGRSLNKRLQGLLCNHIAVHRPSTQSDINIQTVEQDLAE YVPRIPKLAGLVGTIKSLFSSSSVSHSYIHEAEEALKEYNLFTDIPERIYSLSDFTYWSR TSEMLVKRVDTTINQLNMYHSLCRLLMNELSRYMYGEEVVDIFVLGEKELSGEERLFVGS IFAAPNKIIDLITSMSIQAFEDNPAFNKLHANNEMYSKIKSLLEEIRRPAEDEAVEKRMG GPDSEEDEEAAAAAVEEADSNRALEYGDPRVLMHNITREVNVRKRAYLQKVSEAGYNKVI ACIKTQEKLTNKLIDVNLVGTTCLDFMSKMMNGFIERNKYKDDANVRDVCESLTYDEHLY VVNNLIHKKLPVESLPSLGQQIYRLCSGPLFTHCQDRYPMSHNVDMAYACDNAGVLPHVK DDLVKCAEGTINPHEWMTVKYMCFFNFDHCDDLNALQKEMWLHIRELVLSVALYNETFGK ELPILQVHECSADTDGIVLTYNRDWPLILKQKEHLYKSKDLYLLLYRHLVQANESQDALR DPEERFVPPTEPPATERRRRPRKRPRDESFLLDLVRDDDVEAALVPRCLY 770
98 Envelope glycoprotein B, gB G8XUD1 MMMWKPLLYLGVFISLGWSSTTSSVTPSPSNATNSSTSAAGSNETVNVTTAKNATSPSPT IFNTTLRENEVLSVNVTRFPYRICSMAQGTDIVRFAQNIECTPFNPQTDYQEGIMVVYKR NIVAYTFNVTLYQKILTFQRSYKYVKSSYLLGKTVERHGLPLWEVNFVNIANRCYTSFSR VINGETFVAYHKDNYQNDTMWLFEDDYSNTHNQRFVTVKEAWTTYGSVWMYKETCSMNCV VTVTKGRSKYPYDYFALGNGDVVDISPFYNGSNGKTFRENADHFHLRRNYSRLGEFGTVH TELVRHPLVAFFVRPDVTMSWMVEDENTSVCHFAFWDASNRVIRTENDNTYHFSSKEMTA TFVTSKSVADPSKDGYQCIKDEAETKLERIFNTTYNGTYEKDGNVTMHVTNGGLVIFWQG VKQKSIAELERVVNGNSSVVNATSKSSRRRRSTSNGTSPSNSSLPESEKNLLYAQVQFTY DTLKNYINTALGHIVEAWCIDQRRTLEVFAELSKINPTRVLSAIYDRPVAAKFMGDVIGL AQCVNINQTSVKVLRDMHVREGPMTGQCYGRPVVLYTFSNSTHVQYGQLGEHNEIFPGKH RIERCEYPSVKIFIVGGVGYKYVDYYFKGLINLDSIEVVDTMIKLNIDPLENADFRMLEL YTKDELRSANVFDLEDIMREFNAYKQRVRFVEKKVADDVPTYLRGLDDFMSGLGEVGKHL GVAIGAVGGVVASFVEGFISFIKNPFGSLTALLFMLAVLGVIFLIYQRQRQTYEKPLQVL FPYTSQGNEAPPSYESLYSDGKTPQAQEKTKDKAKTPKKTAAKYTEDDAREILDALIQYD QQARQKLKKQTVEDVEEAKPTLLDTLRYRKSGYKQLKGYSENV 883
99 DNA polymerase, EC 2.7.7.7 G8XUD0 MFYNPYLGGGGRGRPAAAPRRAGGGGESSSSSNSFLQIVPRGVMYDGQTGLIKRNTNRKP IMFFNDNKYVLSDDMAWPSVSNPEPLAPPRGRVRFHTYDQSDGVLAVDTVEEVSPRYRRY IVPSGNVIRFFGVMDSGHSICVNVFGQLSYFYCEHPETDRLREVIYSVAELVPEPRSPYA VTVLPVNKMSIYGYGTSCVPHLHRVSISNWVMAKKIGQYLLDQGFKVYEIKVDPLTRLVV DKKLTTFGWCFLDKYEVRTRGRVSACDLELDCEVSDLFCSPEDTSWPLYRCLSFDIECLS AGGGFPAAENVDDIVIQISCVCYGTGREDAGVCFGKSGKHLFTIGSCAPIEDVDVYEFPS EYELLLGFFLFFKRYGACLVTGYNINSFDFKYMLTRLENIYKVSAGRFARLNRDGKFFVQ SGVGKSYISTTQTKVTISGAVVVDMYPVCMAKTSSPNYKLNTMAELYLQQRKDDLSYKEI PVKFLANEAGRAVVGKYCVQDAVLVKDLFNIINFHYEAGAVARLAKISMRKVIFDGQQIR IYTSLLDECACRDLVLPTYHRNGDAAEESSYQGATVFEPETGYYNDPVLVFDFASLYPSI IMAHNLCYSTLVMDGGECPEEEDKVYKVSFENGTVYRFVKSEVRSSVLSELLTRWVAQRK AVRETMRECTDPLKRTLLDKEQLALKVTCNAFYGFTGVANGMLPCLPVAASITRIGRGML QDTARFIHDNFSTPDFLQTFFNAEDYVEGGVEARVIYGDTDSVFVCYRGLKADALMASAD RVAHHVTSRLFTHPVKLEFEKVFVSLMMICKKRYIGKIEGATTLSMKGVDLVRKTSCEFV KNVIKDVLALLFDDAEVSAAAVSLHKSSVELLKRTGPPPGFQKILRRLNQARDELHTGAV HVDELVLSSVLSKDISLYKQPNLPHLSVIKRLAARSEELPAVGDRVFYVLTANPASVRKK MSNYELAEDPLYVKEHQVPIHADKYFDQVLKAITNVLSPVFPRDVEKKEKFLLSMLPARV YLEKPFLAYSVKDVTYA 1,037
100 Nuclear egress protein 1 G8XUC9 MYRNKLRSAGRRSAIRALSAKRRGKSLGRSGSDCPAARHSDGERPLSHTKLTLHDLHDVF REYPELELKYLNMMRMAITGKESICLPFNFQSHRQHTCLDISPYGNEQVSRIACTNCNDT QVFPTASDAMVAFINQSSNVMKNRHFYYGFCKDAELLRMSTNQPTLFQIYHILHFSNHDI VPFMYERNGRVHMHVIFENQDVHIPCESVSQILSAAKGDYEITLDIVRGHVVISATCRVV SSNNSVKIDLGVLQRKIDEMDIPNDISELFERYKSLLHELCNMHQA 286
101 Packaging protein UL32 G8XUC8 MHRAYAGWSAECNSPHTALLNELLLQAHPRQVPGPPNEPGVTNSTHGASDRETNGTQSTD FHDAMATACDLDAELARVEAVDTERLKKLCTPLEIDTRCNLCAIISICLKRDHDQAWLLN YSLLCFKCNYAPRTAISTLIVMSEFLQLLNGHFPDIQFGQLFRQNVLTVFDFHLHFFINR CFEKQDGDAMENENVTMSHLAVVKSLVLADDAVPYTKQRRFSHHKQKIVVKIPEEAKETV GAFLQHSTPGPDRFAHLLYYMWAGTQVMPGVPLLEMTQTKHQNLDSLSDPEDPEYEKASG PMYLSPVPVFQWKNQTCTVCLLCELMGCSYYDNVLLKTLHHRITSYCQNNVKMVDRIQLV LAELLREGTFAAPAGHEDLSRLVATCEAPQAAEATPDLVFCTILRQVGVIGIYKHFFCDP QCAGNIRIVNESVLFARIHPNHFPEVKLAICHDNNYISKVPRRVWLYIYYFKAFQIVKRS YKAKTQLSDFLREFTHILEACEIKLVDPSFVVDKYV 516
102 Tripartite terminase subunit 2 G8XUC7 MSEEENGEQEPQEAEEPYVKFEPMLPKLYELLLPSLDARLNFVNAGQKHAAFFKYVYGQR ATCSHAEILCSKTKLLTAIVAKLMDINGILEEKDESG 97
103 Nuclear egress protein 2 G8XUC6 MEVDKALHHDLVTATRRILKLGPNELRVTDSSLICKNPNYSVCDAMLRTDTVYCVEYLLS YWESRTDHVPCFVFKNTGCAVSLCCFIRAPTKLVSSRHVGEFNVLRVNDQIVVTLKDIED IKPSAYGVLTKCVVRKSNVASVFNIELIAFGPENERDYDNLLRELYSKKSVLGTGSAGGV KESVRASPNRVTPRMARRPVIAAAPPPPPPPPFSSCRGCACHAQRRKTNNDKDSRRDPGG DGTRRDAAAVCSKLGWLGVRLKELRTEAIVALSLGGAALVYVLLRHVGYLP 291
104 Protein UL49 G8XUC5 MSAISRDLLMQLFVPLCVHDDNFHLRLAIAGVAREEELAQCVLSMFITDKRFLHREHSDR LYQRFLGLWSACPPSQREVLNVMFKRIVMTKQYFLFLAYVYLLYCLHKLSSVVSFMRFEQ YDASHVHRGLLAYPGEKLNALLENVNLTLLNDVHRFLFRVDLRLPISTQISSPCLSLLRA KRYDSTNDLIVFHNNVWLRRRKRRSPQVEDFVGALRRRSGQVPCGNPVYVIAKYAVENFC VRCPRYLVPLRGLSLNDDAVRAARSEAAGAEPSKIVLHGLSIALRRGLIGSVIELPVLCF CGLKCERHLTPNSLVAVVCRHCGHCLNLGKEKLQCDQNFPLNSMFYYRDRQEKSVIYDTN AELIHCSLCGSQRLVKERVYEAAWDEVYGFRCLRVQWKAVVGLNAACAVYDGRAGLDVIV PCSSRACDSTAVLRACMAARLLRLTTHGSAFLCQRCQTAAEPRDTCLDDENCAERCSACT VVARLPCQRQQHYV 494
105 Small capsomere-interacting protein G8XUC4 MSSGGSGGSGNSSQSKKEKDSEDKKRQHVGMQVLELREDLLNRPVVSTMLARYTKMSSLF ADKNAFKLDLLRMLAMAATPRQT 83
106 Large tegument protein G8XUC3 MQIYAASCDQADRKFGPRAGSQCVCNCFMYFHVLHTRGAFETLQRATLDKILQEGAKLDA WTEKDLIRKNITPHVFRLGEEVPRIIHTDFGRTAHALSRPFNGTAETRDLDGYTCLGIFD FLLYAYNKSKPVYILVTVDALARAVAFMDNDIYVFDPHASDQCGQAAVYKCRSLDDVVTI LTSFGLHLGTFYYDALIVYMINLTISPIPDSDINRTIISLFRDPDISLPPVPPISTAPAA VAATATVSTPKTVPVKPVTAPAPVPSPKPTPNRSAPARKPEKRKAEKQSDTGKKSQRKST RQHYSCAEALPSLSRYETLVETMERDLLRTALKAPPTSGWVIYSGTSGLPFDGTFLQDRV DHLASQMIDRLAMMRYFVDPSESVVPSNAVQASIQKQLRRLWGFSETTDTFLSILMTHNL NLLRLYNAYLSRRKAPWSTLEKFLGAKTLAVFEYWGKVHGPLMRTWAQNLIRHLEKTSVS ELDVKIKTYVWSHPIPVNERFVCLARVDRDHISGLVAARQSLNSEQLNKQQADQRQIAEV IARIETHQVEQLTPQNVTKSLAGIQGVDPESQLELQRQGTKRFQEICSELNEQFRKILSS KNNQILSGSLPVQELTALQTRVDKASALCQAVVNLRLCDSATQKKYRELHEHIRFVLTGD TSSDVTAYPEELTKLRRAFTDVVKHREYNETKIKELLTNVEYALKDPTSRSSNLTMSMVQ AQLQELSNLDVKKVSGAEERLRAIMAIINSLKQEEEVVRAFVKSFSYHNMPSDQVLKRQL RLKDLLRSDEQLRTQYINGLGGVLNTIIEKMALQDFWKPQNFDMLREMINQLPPGKVTDS LNNTAALFTQLGKKVEAVSKAAADKNMPALEDAVRFFVIHGTSLSEIMATGIGADLMSIF EKLKKQLEGKYLQRVEEAWQKQAKELSVTSPEVVEQFLRTAPSTGAANAVTPLLQEKLKA YVEEETRKINEENQRLLTESQARVQAELARLVDALRSETPSLVAAVDLDGVQNVLSALGP NNTQTLLEKFNRDLLPVLGKIEKQLAKLADGRIYQILTGKPDAATDAYPGDLNILKAALE RLRGFAPNLTQEAGTTLLTLYHRLTFITAGPSNQPAAAFAETEYESKYLQYQECLRGLAA SVEDSKNAIVQEAANIRESVKKDSASSSKKALEKPPTVNRQVLTTVSYPAQDTLKNTAFQ RALDEHVESAKKYVAQEADLLDAQIRSVLELQQARSHSLTARWQELVTRHKVDSLEIQTP EAKALLSDAVGALTSLVQNAATALPYLTAEKTLKWATAFLGDAIREIEQTEDHPQRNQLE AYVALVQKAEQHLVAVGTAISNNAACEKFVSQQGTTTVTEDEIQRVEAAWQDLQPKRVAG GEARHRQVQSELTRMRRSLSELELKESLATEYFELLNGIHSFSYGLDFSTQLQKLRQLQQ RFTELAKQEGAAAAPATAGFPEARQTEISTSIPTAFFLKGLTALEKRVLAGYKFLGDMVS KQFLVNGKIDDVPPLIVPSRGDPSQAGADKLARLQFLKDDAQLYEVVDVFGEHQLVTPNG VPVDLGPTYGNVVFKFLALQRGDRNAASKRSARLKNTVTSRYKAVTVSVAIAGTLKTFWK QISDYDLRGLLTDDVTYSFSTETNTLINLKIFVYVVVSAWTLQTRDDIEADPGPRITLPV SDLCVMLSTLYPEYIYTVVKHPIQSSLTSLIQALDKSTVSEALNTTQNPPPWDIDELKGF CFDPKLWPAVSASRILWDNDFMRQLCQDVGPRKIKSGKLLQYALAVLILPQDVLQCLWLE LRPKYAEQYVSMYDFVQALYQIFSHSYDIVRGTPATDPQWPTGEKVLQSVTLRQKGTQDD DEILKIFIETEAVLDYALGSLVFGVPICCAIHVAEVASGTRTLVARHLEYTGGDQDFKRI LRSRDLNFGYLISQTWTNTPLEQCWFQSQAKKLREHLQHPVKLDFVPLVVYTPTDRYVKS VLKPPAPSSAETGRAPAIVVENPFPLIPISEAFFAPKPLQFQRVPVDTAFLQEPPPRLLE TRTDDSQDADASTDTDDSAGADGARESDGAASLDSVPSHSFGDPVFRQEENADTVRSKDD VTTLSPSASTTSFRQHPATHLTHNVQRALQIIVSVRVDLRRLAQSVIETTRRLEFLYL 2,158
107 Tegument protein UL37 G8XUC2 MARRLVDLSRIIEELRAKNHDAQGCLTTLSKIEIAAIAVQEITASKIRQFLQYLPVNGYY FNFVQKNVAYYLLSHATLGRSVDPLGLTGELISELEKYVQRNAEVSAYELLNNAKVLEQL KAFTAELRKIQDSFDTNQFLKATLDKKKASKKDLSDHGTRYLIRSVLSQVNQAVVDVRPL INCRLVAELVDHLYRATTTWFRETLQYTSFIKDTDTDLDAILKMVYFYANHRRANAALDA AFAELATEGRQRFRLFTVPGLDGDQQAGAEYIRETSFKLFSASLTDKDSSGLVFPMISTE LSVLNSMSVQNLFFHPGLVYRLLNGAISPHNLGDRLDLTLNFLNGTVASLFLRSTVSTKS SGLRELSEQITRLTELGLNYDTSRLYAQMCLTRQSPDKHALTQRIADYLREIGTQICQIV YNAYLFFLCLNVYSPTFLFNQRRRILLEQQRSLLVGSRSDLDAVWSNVTGNVNYYFTAWF TEDEFDVCVKGATAIEREYLYRDLLNKWGDILFTLRNRHPDPAPLEQSTQKITVADIISQ CAMVNLSNTSYESLLPLSSHASFVEKFVNLVIVPELTQVLNVPYAQFRTVGAPRLLQIIQ ACRLLMPGQMTLYHKLVALYNLTNYVSKIDGGVFRVIYNLTLEITAILEGLCKESLTLNV DLIAELMAESLSNNLRDNVDPIIDEAIRGSAPVIQQYLEHTRLCYAIAMSHGKLVTVDSR AAVAIVLQSKTLLTMPLPDLLTAIKYLLQRDQALNDSLVQAQLRTERIWRRVSQVVDDMS CAGQCSQAHPIYTDIMKSLKKTQKTLKAVEQKFSNAIEQSQKSNRIVASSLNRIVKTCSV LSNENIAEHGLQYCITEAVGTIKLHQAYTAVPASARAEPPSNTADLLQKFFQPYVTTPTP QRTALDMSSTTDVSNEMEYLDVFGNQYTPLQDLDKLLNWYVSPKAQAQEDICAPLRPATA KCASSAT 967
108 Capsid triplex subunit 1 G8XUC1 MSLADKAGLKRPRDDRDTDLKKILRPEKDVNSVWPRYVYGADHQAITGRFFVPDGLVELE SQSGVLMFVFDTGVESPRTVYISLFLLAAKAANVSANTRCVIVGIYSSSMAATVLSWLDG CLQTLHRRLRTLGCVQSASSGITSLLTCVLQGYLYNLLKTEVFSLPVPKDLYFQIEDESR SGTQYAYLIIIYHCGEGETKPGIYVCTTSVFHLATLVDVIRQRFLRERFDFLNKRITRPS YSVTCTGVIQRLGWCLKEDIHAGVIAHKEAKLPVMRLSQFHVEIGPLHEFV 291
109 Ribonucleotide reductase subunit 1 G8XUC0 MSSLNHGWAVGKGYDFALWEAEMDHKLIQIGDGMRSIIVHTCSGVRRTGLGSGTQQQGEG GEGSGSPSSSPSPPAESGGLPAVPEEDVTLQRASSTPPVRRDGPSDRTRKCLCHGRRGPR RFCRSRQTSVSVYDVEGVLREIEDAVKRQESFSPVALYEVIVKYGCSLVKFRPRLDLLLG RYYHETNRGREHETVDVYCDSEAVEDEVARFFCYHRDYLATTFDIVEKIVKGLGCRGLVS AIITLDQIAVQLGGKEEAVAGICLRIVVYLVSLFQRSPFRDIYLHLFRVEGEMGLFERLL RRIQDGDLSLSVLASAVAGLVGSPGCDAVLASDRVEESDWHTVQRLTQSLAQRVSVSINV TRMESDAINLIRCLSAQRDLACGREPIKPTVCIYFDAWDIACAEILDYVVRGDCTGLHFI INIPDVIMKRRVAGGDEFALFGRGVSRRLSRLGNEAVFEKEYRRLEQCTRHLTACMRIFF DKLNTCLILGHMGVVFCHNVVRYSVMDYNVGIPACLGPDLASCNFTNHHLPVQRVCVNLS KCVHVCAQSRVSQRSYEDVFVGNNDRCFNFQMLREAVRDAVIVANARLDALWATSDSETR NALDKLRGLSIGVVGLQTTLSLMGMTLYENMEFAERIFENMYYHALRASADLCVAGLARF EWFARTVYSRGRFIYDKYSEYRLTIPGEDWASLRQDILEYGLRNGQFLALGPDEDVAQLL NVSPSVWAASGNVYEVKTPLHDLPSDESLRIPRADRYFLRMPVVNRAMLKYSDEEVEKIM VHDQSVVEKKEYEPFVNPVTKLEHHVLCMCYRGVCKFVDQCIALPIVRNYSLPITAPLDR LCEMYYFGMKVGVYKCCK 858
110 DNA polymerase processivity factor (Polymerase accessory protein) G8XUB9 MERKMRTSEPPTLALRLKPYKTAIQQLRSIIRTLKENTTVSFLPTPALVLQTVRSYCVAK ITFNSSCLYITDKSFQAKTINNVTPLLGNFMYLTSSKDLTKFYIQDMSDLSARICMCAPD FNMEFSSACVHGQDIIRESENSAVHVDFDYNVVSDLIKWLAPHTKAKRNVKKGPTPAGTV QVLVHASPPALKYVLGSGNELEFTANNRVCFHGVKNIRLSVQIKNLYQALMNCAVTKLPC TLRVMTEHDVLLYVASKNSLFCVENFLTEEPFQRNDLGNFEKNYKRQITNNVSSMHEDGM DTDTTVESAPSSKKHERQSRKASMDQEHGSKEKYDQHKITNYMTSKGGSAGPSERGPGYF GDAKEESESDESVTFEFVPSAKKQKCT 387
111 Tegument protein UL43 G8XUB8 MVSRQIGARRAWIPAMEAPLDKEEPMAVSCDLVDMTYRASVDSGAPKNLLSLVRIRHGTK LLLPWPVGWHFTYYDFRRKGGPHSLSIKGIFKNYLCCDKFAVPVGIVGSEGGVNSFALVV VIGEKGRCYVYSYLEDAIYLVSRQGFKHLFEVGLYNLPPLRDEFSPSVALANGSLSEFVA ATDLLSCWRLCRQHEGRVYAWSCDAHSVSLTVCGDHVLENRALHNEWLQATGSVNLINVF EATAWVDRAWLRIPILVNESGAVFGVDVDNHRTYFLARDLETFFKVAFLRFRNTYRYTNG CFERGAGTASASASVPAAFAPTDCPREVFCRRKKKTLLRSWLLRRGSL 348
112 Protein UL42 G8XUB7 MPLSPSPPPEYRTVVGDGPQNPGGSGGSGPGSNRNTRPTRHPRDPRDPWVPRRPRDPDSP PSYEEAMSMPRVDGIPLPPPPSTTGFPPPYEEPCQPTVLEMELIAGPAGSSRSSTNSAAD SLLLSDEFYSGVRWTIVLFVVAVIGLIFIAVVLGVVISRGKGS 163
113 Protein UL41A G8XUB6 MGGHNDTFTGAVNECDWLVGVGIFMAGGFIAAFGIITKIMLARRKARAMVRSGSEEVVYE RLSLEEDTEL 70
114 Membrane glycoprotein UL40 G8XUB4 MHGVVVFLVMAPRTLLLIVSCLVCGLMASHEWRCVQSTSGFRAENIPSKCEQYRYNQTYL LSNETTPVRLHAKCCSNDSHHVHQPPSKCVFVVDVYRENCTDCNVTGRVTFAPDCINRRM LFGHSDPLLTLLMYGNTSRPDSFDSMDYTRVTRENRNFTVLLAGLRQRDLYAIGNASDQA GTAGRLIMDLFEADNFQYLLPNEVLFLNVLGVIALTLCCKFLYGSSSPTP 230
115 Protein UL38 G8XUB3 MDCESHEWLQGSCANIGRLIQASILGKTALNAQIRRLMKAKAVLRHDSGLLVSICDITYD LLILDHVKKAWLERSCASIIGQELIVFGVAEEWETASRYPSRQVVFLITPKWDVFVYQGG ILFYLAPTMSDFWHCAIVMEYWNAVFPKPLYVHVRPYCHSMDDLLKVYHAYDLERQVMAA RNEKCTRTGRKTFAKSVNGVIRSLLESYRSIEVGKIPSLFVERGSLYENANIQFFTHYLM TKSKPPEDETHTEDGTTGPELPEQPCCSSTLSDTVRGAVGSCEPEQEPMMC 291
116 Tegument protein vICA G8XUB1 MAAIEVLRHVASLHHDFSALDSFLESESGLRLPLEWPPECFIQLRSLAGLGYFEHKYDAV CNKGRYVCCKEKMHPFGFVCHCARQWRYRYVLLLGASGSIYCYDDEEQCVYMVARSVEVL CSRGLRNVDSFYAYTDLVPPGIECDEHIEQIIEVQDDLQSMAETVADIGCRVYPIIEPAG IDTHFAIYTTGGLLYKTFTDNSVRNEALYVHVMGKATTQIACLCDVVGVLGCMSVENVFL ARIFVLVDSFGVVYGYNDTFCRVSRLADNFEMFIRILGRKALQNYRYDSRKISVMRLEKP PVCFHTVHDVLPEPQWDAVDNPFEPDREELCEADRFSAFLSSKRLMEDYNKHEATHELNC VLIGNVTSGCFWAQEMKALTELPVHATSRTTNLSEARRYVLSLIDLSFEALCTKMESEDS DEETITSFIFKKPCQKCVCRKRWRLFRAGRKEL 453
117 Protein UL34 G8XUA9 MDIVITTRDFSNDDSQTTPADGVPNTLSSSISRAYRSILRAEAKKKYLIQQLPQHTLCAR RNGNLYLFCTDKDHRRLTQAITQLKRSDLSLETADIQAAVGNVRCRLRRVDSPDQNHIQN TLNAICTFFNQLVFVAQMRHYCEKNERALWYSREELSKRCGEKSDLGAYIQRFVTTVDNE RHRELCTVLIGLLHQTPHMWARSIRLLSKLKNYLESCFMVLLQDSGISVDSAFESPYQNE AHKLLFYMGKTDVCQPALPENKDAPECFDPPVIAT 275
118 Envelope glycoprotein UL33 G8XUA8 MEVVLEIINNTAVYQQSYLHINDSCNATTSLMTARSIEGLVNTVIILVGAPLNCIVLLTQ MLSNRVYGYSTPALYMTNLSSANLVTLMVLPFIVLGNRGYMTGSIVTCKFFALAYYSSCT VGFATVALIAADRYRVLHRKTHARSSYTRTYVILGSTWIISLMCATPVALYTTLIIHDNR FGIGQFTCVVFFQYGQIRTVLAGLKSMIILLWGITPVTMMTWFYAFFYKTLKKVSNQKRH RTITFISLLLLSCLIIQTPYVMIMLFDITALMTWPTEDCQLLNRRKAINTLTKLVPNFHC LINPILYAFLGNNFLEKLKQCFRGQLFDRRAFLRSRQNSMAKQQNNTSSRRPSVSPLVSD PAVSTLRSPNREGNTSPTGTFPKKTAPQSPDEESVRTLPRSNPSKTPSVSWVPPIPPPKP SQKLPRQALAPQGLPGRPQ 439
119 Tegument protein pp150 G8XUA7 MSDLRFIGLPRRNVVTLVQFLKTLRQRDDVDLERHKKVFKKSGYRFLPRRTGLFNQLVLW MGYFRGLQKLRPDVSQPLAEFRRLCSSVSQYAVGHPEIDMGKVHVRAAVATLEREQKNAK DLDQETIKSVLEAATMLAKNVVYGKWITGGYDFVNLRRRDVIAIEENLNHAKSNFSKLEG LTVNLDSRRNPALVNECNKLTYVGRTMMTVMGSWEALESKCVRRINELCAALRSEFRGIG GFEAGYLGNLLRTRVRDGVSSNDLLLMLMEDFEMYEDAFPKPLGHGVFSLGAGVAESQAK AKYGDEWDEDGSRYLPVFPKPPDSGDLLDLKDPAVRRHVFDIEPLDDEEGFGYSQNRRHR DYTWDVQYGGDQDKPKRRGSSPKGASGSVEDLVDRLGDLDVKGGKKPMFVFEPPSIPMPS TVTPFSQALGSPSSDVTVLHDEQAKRSAGSGDGDQGDDEDDEVAEEEVEEEEEPDEGEDE EDGAGGGGDDGAPAPAAPVTPEEAAANIQKIVEAIKEDQLSP 522
120 Protein UL31 G8XUA6 MEPSLPELFDETLYGDEFLFALGVDMDETQIVPQTPSAVDTSVTAHVTDNAVDLVRLGEI AESSGGTTDNTETANVTSSSSHAAEPRETVATEIASAESTATEATDPNAAESAEPLQEVP VVDVPKTPEPPSQKAPTEKKTSDGKATVKRRYVPERRQVSTVPNSTEHEYVLPDASIVHA WIDELRTADRDNIGRCVRHTYVHHTSYYLSAYESYLFGVIEEYNNDSSVLHKATFLHGCI FFSCSTVTIQSEHPNSWTNLMVPKSFIRELFFLLCSTNGSSIVCQPLITKGGLCSSLLIH TEPLPPEQRYGLAQTQLVLIPMVPYHWSKHAVSFIVVPDDDKHRDGALASTSPASPAATA AATEVTTTWHPPVDDEIISPFGQATVIRHNNSVLFTLKQLSWTSKRVLAGRRKRVVHYIS QFKGPWYHEFDPTRDAWVASKNIEYEFMGLPFTVNVDTLCIDVKSHTLIGTVSTSHCHRI LDKLTARNMPRSISFYITLMRRRYVDLQFNRNPSIFFSGDVLNIPFLSEPDPFTAIVHAP YDINFTTQTKHTVRLDITYTQTAERCFLVANVPHNNSFYTGLRLWKTGELKITLWSPSKT LLIPQGAPIAVLYQINDTTGDLIAHNEKTVFKHQFENEQISFYLGSLKLPEINFLASYYY 660
121 Protein UL30A G8XUA5 MAECGSEGTEQADLEKEKEVESLVEWARFLHLRVQWNLTPSVYMCDLKKFLRFYDELTPE RQRLFESEVEMVERRARIQHMKNTHRRRASARLSVGG 97
122 Protein UL29 G8XUA4 MRRARRKRTLASPTVFSIRELLELSDGRHAEELHFFLETFEGSCVSLGWPPQSIYTVCAS LISCSMTDIDLEHCQSSFFGEFRRLQVLGIACHANARFPLLLDDYGTVYCYEMKDDCMYA LANSVESFLAKGLIRCDSVHEALCLRLCLEGATAASPQEQRQDVNRRCRASERERYLYSL AGFAELLRCEDVIATTAYVQSHLSVTIPLTWPEKHVLVLANSKQLDLTMSMLRKLQKSTP IKEPVNVLGFVEAMSAAQTFFRHIRLFQGDSGTVYAGLPRHDKLTPLARNLKEFVRVGLS PLIGDYRYENIGTFDLTRLQETYPDARLPLKKRRILIGHFESLNSLYIRGQPKFSAPWRA LRDVWTFRCRKTRIWKDGMQLQRFVRVHAGRWLPLAWPPMYGFMIGDCYHFGAVFDRKTY RRFSCFRDCVRLYCIGFVSAYERLPDVSVSPQVIVSENGHVFAYAPQEDKAYLLGLTFNE FFEHGLGAMYSYFERPFVDEATENQWYRHSFTSMSELSNHLGDRRQMVRFCHLNAGCKVR LGGPQYCVFTFGSWNASELDEPNLFVFNVLERAGFTVVGWLEPSSKAVFLDGEGAVYVSL YGIVLVKLGETLRGFIRHGSFWLRYPRRFCFLPIGSTRRAVSTRVTVSCDLQEYVVQEED GKAAEAADAAAETTTA 676
123 Protein A20 G8XUA3 MLESCRQLARKWGFKTCISDLLGIVHRSSRDTFRETLLTFIHGHPDGFVLIYWPQDVVYL VGPEKLFGIDSWLEETVQSFELLQQREWVLFGGVIRTDDNWFRHRDVWVLFTSAHELLTF DPVARLLWRVDGWRYGILYLSTMSCFYDMRFHSRRAEQIFGMVPSRSEGAFLCRDFNYYW LMAYVTRHAGFAFNPADGCGYVVGTAMNPEAVRGVSPTVLRCLREAGYEVIGRTQLYERV ILVDVHCNVYALLPGSYLFTLANTFRGFLRAGLKFMVAGRRFCFTAIGSSFVPVGKRVPF PCQARYSLPGDDELMRHLNPVLQSTRHGRPARG 333
124 Protein UL27 G8XUA2 MTMDVTLFNDPLVLYSYLRDSEDKDAMCENFVSDYLAPLRNRDDAFRAGFFTARFYRCAT PSYRDGSLIMSSYKHRVITMRRSVMKNSALVTAHGRYGIRGLALEWDTAVWGILRSIPIP PSSNPLLNKSVRGFRIFLSQARFLPNVSRVAKRLCLAMATAQHVVWSLLNYKCCGTITHF LRQMCSLTVDIYDKLYDTLALFQDDDTKIAIQQFFINRLCEGAGLDYHGHRHAVFFKLEF RRAAERALALMYRQLCGCEECGGTTAASNAGPDSEQRPNVHAWPRLESVAISLSNYPDLG RFHLPALRHLKAAEQTRLRDAVSRDLGFSLWNHNGFEPRFLLPQELRGTTDKSYVLFLVS NIVFNLKIIWILRQIVQREFADAVQFLAFDRDILIGYLHRRHALFQEGLVQSEAHRQLVA DCQRYLADLRDIDFANFERRTFVESLCAFMDLAEQIPDYRQLSLIDKQRQFLLHNFRIRC LYETPSPETRLGESLCWYYLKRGDVPLGKEALLKINTRLSDAELCNDANRCRRRTWLDLP IVTVLPVKRHMQMARYTNVYVRRFQHGEVGGGV 573
125 Tegument protein UL26 G8XUA1 MEGAGEECPLIINGQTIADFVKENCDRSFDLSWPSGFTLLVGTLQDTILTTRDYHFWRGL PQMEGRLQIIGTVGRRQSMAWDRRIAGVAGSGRVYLYEIHEQSYVGLAAGSLKELLSAGI RRDYFNNVRDAIQQRARQMSERTTRTARKRRAESSPSSSPLPSTSSGVTSVERAVVRRLH LEGEELTDSMFVEGTMSSSLPC 202
126 Tegument protein UL25 G8XUA0 MSHGRARRPSRLSLRQLEDGGSSSDEVFTPGPNPTSPRSPPFRDVERGLGDWEPFNVARP DTPVSSFEIIDESNVERRPTPKPHRRLLQPAPVSFPVDVPDPGRQPSPDHRRGRRSRRLR ESKACSFSSEDEEDDLMQFTFSASDIEDYEQEPVNRNLNFDLNVMSMEDIALIEASLHTA SLQQLARVNECIPMPVYALNHLVDPVFVPAASGEKALARPVVTFAVLLNYYCKARNRVRH MKRVLEATVHGPTVRRMGPQIHANKNRAVVLAIHFLFTSKKVNEGQLLNCLLYLDDELRK RIMGHTPRKTEIYRAIRKHNVLFRASTYTTRDALRLYEENLRRLNRESCDSVKLLCDTSM SPLSIINDLSFLTATKLMIMTLQRNVRALMCYLKHQLHALSLLTYLTYLQFPGYLRDSYL QVTDSIHQSVMSEDETYLYRAHHDMFQFWRAVKKLDALVCPDFIGFALRQGCLGTEAGQG LAQSIVSDRLLREPYDAPFQPRKLVTRNLCYPHFTHLPSYTHTPVEYFFPPAGVLQKLFG SHRRPENDMEHAYMLSAFKNFIVSEQPRFETTSSTSSASAGYEGSGAGAAAASVAVTAER F 601
127 Tegument protein UL24 G8XU99 MQTLAVAMQIGPGCLAAYMRMHEGRQVALRWPPDWSLVLSDLADDPEYGPRDVRRWNEYL CCKMESLQFMGRAGRLSTSGGFVGETLVLLISEEGRVFCYGGPQDDAVYYVAEDLIDFSQ IGLHHVERLHRPQYLRNGYVKQEFESFIRAWAMGFDALARFIVRNQGRHLPMSYPYQSEM RLCSLRCFEASAFSGTMMRLARAYFGSRMIGLGTVDIQRKSCRRRSKSVYYDWPKCVIPI FMIDDGRIFACDLLRADYVRLADNVSMFMCLGLTRYYSNRRFGGQKMGCHDRVADCPKDL KHVVSA 306
128 Tegument protein UL23 G8XU98 MAPCSCFWSFRPKKSVQLAWPRGRFLMLQKRWRSVKDNKAEEMRLSEYLCCPEEIYFLGS ICTKAFLKHGESECPSEIYVGLSGRVYMYIDMLYSDAMMVVANDLAGFLKNGLRGCAFVN VGTTGLPTDFNCVSMTTCENLDAFCGWRNGHLGEVMKLGDGAAFMVVPESIMNWNERRQC SVETGSFRMEPFGEAYLQDHDEDRRLLLFADEYLRVYGKTEEWTILIASGMFEFVTRGFF RYRYDGIFYGNKKIRRLSRPPSCPNGVRHMRASVSSST 278
129 Protein O10 G8XU97 MKTLQKPGLLCATLGLVFILQTADRAAGRPIPTTTEPTTTLNTTPEPSSVTGNGTITPGQ TNASEPTSTTGNVTTTTPGHTNVTGNGTATSGPTSGPARIVTTTVDPSTVPSWMKILRRL NTTTAESGLEEHDSDADGHDHHETTPARDDPRSMPHTTPSGMRHPYGYDSFGVLCLLGYD CSNAKPFLQTHRPDLLVRNITYSLYLSRTYNHRHVI 216
130 Glycoprotein UL22A G8XU96 MLAPVRFAAILGLLTHTLVNGFTTKNSTPDETHATLILEEISSGDGEKGPNDDKDSSTPP PPTSPKPSSRAPSDSPLTTTLSPPSSSSNSDGSTARTTSAPTRTPASPVK 110
131 Protein UL21A G8XU95 MGGAPEVSVESACRNVLPGARVVFPALQRRPPVRHHRVVLRRPRRRWQFEGRDDEEMVEG SREQRREVMVQQMVPENEEQNGVGGNGGGFSPRRVPHRFFIGHEMIVV 108
132 Membrane protein A18 G8XU93 MLSRLLLVSACVWGGGGGGAEISHSLTYCFYAVSEYGKQARLRVLGYVDDTPFVKFDSKA TIPRVESITPWLELDNSQYFEKNTEKCKHLERNFGVHLKMAMGYYNQTDTKPHTLQLLLE CNIGLDERFLSGHFQYAYDAKDHISLNDNLDTWVAANVAAQITKRKFEASNLQQKLKKYL EGECIEWLRRYLTNGNLSTYFVSPKVSITKHETHQNVTLKCWAWDFYPAKITLEWKNDNV NVTDLTEFVETRPLGNGTFEKWMAIVVQLGEEWKYSCHVHHHGVTFNYTLPQRFQTSIAK GPVAGGVGIVIIVSVLAVGGFTMWKFKNKRLKTNRRYDEVFVTDAEFE 348
133 Membrane protein A14 G8XU89 MSQLVILLLLGCYLHGSVRALPFVEYNCKVKLKCGHVQDTWYLERAFVYYRLLPPDPAKG ETSGLTWYQVDDDHRQENATYSTIWVCRDRFKLAIGCDRTRVPTLHAFTFLLHCFAYPNG KFRASYTYIDSDLRVIPLHANVTHWVSLADGDARMKWYRQRRADMERECEALLKPVLTSS LQTYVTSDWVDDHKTMLKCAAFNVNPEEVNLAWWRDDADHIHDADVTTGFFANGSSWKLL TLMVPLGEEYRYTCRVQHGSWAPATLRLAGPHQVGDMISTRTVVQIACCIVIVILLRMFL KRVMPRWIARQKAKHR 316
134 Protein UL19 G8XU88 MASRHGAPDEPANAVSDDEDNSLYSFFMRRLPYPPRNMLLYLRLRTQYGPGSWEHLTSIS ANNERTLFVFGYGRMRIERFSVPQVQCADVLKMKRIRSPNSWIGLDCYPDMFTGRSFNQ 119
135 Membrane protein A13 G8XU87 MRPWSLIFATFSVVSCHILQHIFTVVYNETSTFANCTFVKSLNNVTFLRFSYGNTTEDPE PKFFDFNNTNNTFATVDYFSNNKSYDYNDSSFNFNFIFGDFDTKAVSLFNWTQNIPTSNL TMNMSYMDYETMGMNLHVSVFPKLIRQLLNYTHSLNVTNLTDVSTFQKLEYCVTNENNSF QEGYSAITLNTRSTAYTAANLTTWLATDNVSRLYVDSQDYNNTVAIARSVNTTYVDWIAM YVNASRWNVTPPACYIKLQNESSSTPTVRCTATGFYPPEISVVIYTKENGTIRAYNATGP GTLPNHDATFHHHVTSTITRTNHTAVHCNITHHEHTRTIGLYDDDSMNATAHATRSHVTS LVLAAVCVCVLAALALWILLRPLCRVLFFRLFSRYHGAHGVVELQST 407
136 Membrane protein UL14 G8XU86 MPSQIRGSRLAQVGAVARLMPLLLASLSPCCTAQAEGISGNEESVGPLLAGHGEKISIPC FSHTTGQYMTGLYVVFCARHIQNAVLLFRNGTKFLDTLSKHHARHGTIVYHNSTAGTSFL QFSFTFEEKMAGRYNCLISNLTHTVVTTRFTLLDRVLSHRYRKYDVPNMVLPTHANTTQV WSAYPNKLHHLTCVTSKHTIYDVFYIYTAMSTVSCQHLSKACRHLSLAPQLTSQTTPGLK VHPARTKDKNYVPVVISTTSLESHRDRELVQILNIAELALWVALLTFIVGLIMLLRSLRT ALFPMPLPVTSPILPSGTLIPVKSPPPYKVLSELA 335
137 Protein RL1 G8XU74 MPSELASGPGKPSEGADNGYKRHDGAVRVAAATGEAESRPSAPEPEREAERPSEPSEPSP ALSSESAEHYLTPSLTSDGRVPFPRPSPLLLSVALFQEDMAARRANWSCPDATPDPIGVS PGRSPIYSGSCSLGPYETSYQTREAERQSRSGELLATCWCLWLSRREGTSARAPRSGSAV HLLAARTRDGHADWAFMRARALCLACEVVDDPAARYAPDWEGGMPVYPRYRLALLLGGHG QRLQLERATLDEAEERGWLPNIAGRDPRHSYYVYGFGRVYERRQGTWMPSETFPTPLLRQ QMSAPSLLGRRPRPSPGPQQHRIPEPCVFWPPRPQLQRLSSSSSEGSRSRSRSRSRSPLG ATAAPSPRLSSPPRPATRTPSRPSPESPSRLPPTATSTSPPRSPTASSPPTSTSVLSFGT APNDYRDSSPTPSRETTENHVTPDTVPRPAPICRRRLGTDVQIVEMRREGNSSDGCSLEG DQDLLVDLEIDAEEESEDEPTPQPAPKPTPQTTNHSRSRRRTRRGHRGGRPRPALRR 537
138 Membrane protein A1 G8XU73 MWYAFSSLPYFFLCFFVPRFALPGVHGPSQTQTELARHAMQPRDERSAEANVHRQQSKPP LRCRPLFFVLLPLLVLVGSAPVQATLSKKAHRVYSLRSLSKTQLSAWPYTPPQPLLVLAT HGQRLALTCSVPRSHSMFYGMKIDLCHDSDPHEQHRRPAVAFYYRQNALTFNSVAKLIRG KVKVSNATSDFILVTLSFPFTRFHTGWYTCLVSNETDTVLTVTHHIFDRVVRTRQRWESP LHPRLGSLPSGDNHGGNRSADELLRHSRAWTRHPQLMHHKTCTSKKAGNATQRYVEDPDN PRRDPDLYPKAIQFSSDSSYDLVDDIFYPRPSRISCRHRRLPHPCGYLTDADFLHLHYAR PPPRPTNPISWWRRHDEWHAAQDFLKKNKRDRVAQAKAQLARVRWRLMLGEAALCVVGVA LLVLAWALWRQNR 433