Chershoee
id Protein Name UniProt ID Sequence Length
1 Rh230 A0A1L6Z377 MRPHRSPHSWQHLRYAGLRTSPDPQSHRLPAPPTHWRPHQPSPLHHMSGLMHALPTPPHQ PTSAMHPPTHAPGAPTTLTLPSLDTRTRLASIPPQQRALTKDEFLLMATAWADAFIANTT ARATRKWCQRQTGQLLPLGRPANFYAVVTPRSHMRDVGATDLRQLSPTDDWIVLVATLVH EMSPSPQDPPTLCRHEGLFLAIGCHFRVFLFDLPRHTLHLAATDADDFFRHGIGDLPRVY ACPTLPPLTVHPPEPVELLSRTWPNAAAAAAAIGHTAAGQTICLQTPGRPPQPCLLTTCW EEVERWQPFCKWPHAGSIVAAVRNFISERLCCAFHLLGIVTTHPWLEYLSEWAAARANWF DTRSRNPSREHTRLAAYQGCTVKRRPKPHKHSRHNAPASDVPPAATPGPAAAATAATVTH SPKCHAELKSDERAEVDDDGRLLEKNPLAVMLIIIDELGVVYGYCTYDGLVYPLAEDLSH FLRVGLLAALTAGYAAASPDQAAVRLLPDQDPYVWERPRPDALYLWPRPSGGPRDLASQF AFLTRPGRWRLDTETSTCQSRDEDGWRVRDAQALALPAEAGQEPIPQSDQALVSRALRFD LRYWKLPSGPEEDEDPGEDDSFTLLPYRTWAVGDYNPHWDPQSVRGPNTVMQRRICNHRA RANRPFRRPLPIQPRDRDPSVFPKYSSDGVLIVPC 695
2 Rh228.1 I3WF96 MGALTKFHRILRRGWNAFLSTFCCRRSSCTNKAQGQKPPAPTSTVDDMLQSCWDTSANYL HRELTTDTPCPPPAEAPRTMEAYWQAMKSTFHDNHFGDTNTRGFGNPCYLDILPGFSPVL RRKSC 125
3 Rh228 A0A1L6Z399 MWHAIAVHTPSGVASAARAVNNALSDLVCRISMLCARRRRRAVTQETATAGSSEARQAEQ KQEQPQTSSSTSFLGRALVLVGQQLLAANQAACPPPAWLWK 101
4 Rh226 I3WF94 MNRPRDLIPTLHDSCTQTELRWRRVLTESHALWCNCGDWTPHVECVDDAYFQLRWRSRQE RTALRWRRQMHRLHNLWCMCGNWREHALYRRGRLTDSSSGSSASSSGESAENTFVWWKCL RKWNILWRHSYDFFDIPVPPESERETPAYSDSGSEGTPCTSIIETHRPQDCPIVMDVRPW YRETAV 186
5 Rh225 I3WF93 MEKEETWRGLMVYSHSLWCICGHWKAHIIMSDEANSEEVACSNWMEDATMRWIRNARETH DKWCRCTDWRGHALSLDENRISLVTLPAAMETKSSTSRHNSRLSCFTRVFKSFRKKGRCG RGSGTASNSSGASTISSHSWQWYRVTPPTPRQAECQRAPHP 161
6 Rh223 I3WF92 MPTPYRRCCFRPLWNAIIIVSTIAIAANACHIEVGEDATVEQECRQRNVLLATGQLTPHS HRPHVLEFTFSTKDRLGSVQRLQLHITGLQLNNRTVLDQSVYWRLFSRATTVEGGVKQKV KLRLISEQHVPARHCEITVGKDSGLDETEPWGLLNVLSYFVWWVAMCLLAIDIIINAYQW IHKINSKNRTAVSVRAEILRNEREMFWKRRRARHGGISESPVSSVPPRYACNEPWSLPST AAATASNQSAAATPASPTPPEYSSSSVFPPFPQ 273
7 Rh221 I3WF91 MLTRPWYIDIWWITLGCAPAVSVTVLLTTATVGAHSIVVHEASPPPPPSSSSLRLPITSP SSTHFNNPSKSSHIERTASAVGPTRQRTNALNRRRRQQQRKPYTCITGTHWTTNLVFTSC ENTPSFVKLEGVRKWTLKGQPLGETSYYGGCCRLAHGENAYIILANGYGPAIHGHALRVD YATTNCTQPAIPFPTRLEITSTQGLQSRCGSNRFYFYGLECSTQLAFSTLGVVDVRRCPS VLAVRPLRRSGSFWDEQLRGLSLDILVCLALVMLLFMEIIPGQAFRYPIGTWRRVSAFPS TFRLHRWVKRNLASLFSSETEHQKKPSEAAANRTWTVPFPCSHTVLLAPIPFRLRRTMSF PSLQFPTSSAHNVSQITDNPTHGTYESHNLPPVTLPVTDYIEVIAEHAPIIYRQDANAVQ AMLLQAALERDHNRQHDRNRC 441
8 Rh220 A0A1L6Z347 MTSTTMNATTNSSITPQSSSTTMTTNTSTPGNTTTGTTSTLTTISTTSNATSITSTLSTT GNQTATTNATTNATTFSSTLTTSTNISSTLSTVSTVASNTTCNSTITANITTAFTTAANT TASSLTSIVTSLATTIETTSFDYDESAEACNLTDIVHTTRSVTVTFYTIIFILGLLGNFL VLMTIIWNRRISFTVEIYFVNLAISDLMFVCTLPFWIMYLLEHDVMSHASCVAMTAIFYC ALFASTVFLLLIVLDRCYAILLGTEKANRRLLRSAVSGCMLMWGLCFILALPHFIFMKKG TNVCVAEYEPGLNNFYVIFINTEVNLCTLVLPAAAIIYWYLKLTKALKTHERLRHRLTSL NILLAVVIVFALFWLPYNLMLMMYSLVHMQIPWECSSEKILRRSLIITESIALSHCCINP IIYLLFGPRCRSEFCHLLRCCFTRLCPHRSWSSIRAETVSISLSHSQVSASSEDDDNDVH DELQFLI 487
9 Rh218 Q2FA79 MNNTSCNFNVTLNASAPSRYIAIAMYSIVICIGLVGNLLLCIVLVKKRKLRYSSDVYFLH ASMADLVSTVMLPLWLHYVLNFAQLSRGACISFSVTFYVPLFVQAWLLISIAMERYSNLV WMAPISVKTAFKHCIGTWIVSAFVASPYYAYRNSHDEHECILGNYTWHINEPLHTCMDVV IIVWTFLAPVLVTIIASVKMRRTTWGNPRLNEKNSDILVVLVVMTVFFWGPFNIVLVIDN ILQRYYDTTNCDVEKIKHIMAMISEAIVYFRGITAPIIYVGISGRFREEIYSLFRRQPYN DLDPDANQFMIELTSQGRSRNRNARQSESNVPQPEECFW 339
10 Rh216 A0A1L6Z344 MTNAGHCHINESLASYGIAPAATITLYSIAGICGVTGNLLILLVLFTRRIHWFANDIYYL NMIFTDFLVFITLPAWVYYLLNYTQLSHYACIALSFVFYVSIFIQADFMVAVAIERYRSL VKNKPLSVKKASVSCACIWIIVIIVSSPYYMFRSQHETNSCILGNYTWHINSPFRTTMDA SINIWSFVVPAVTTLLIARRIYVCTSGNKKMNARASGLLEAMVISMLFFGGLFNLNIFRD IVSDTSEDNKDCTYLKQEHFIRMVGVALVYGRAIFNPFMYMCVSTRLRQEIKCLFMRIPY ETLDAEHAKLMVNLKNRNANVPDPKPREYESVL 333
11 G-protein coupled receptor-like protein (Rh215) Q8BC83 MTNTNNTTCHLNGTFETFKITRPVAISAYTVLVVIGLLGNIVLLSVLVVKRKLKFPNDIY FFNASLADVFAVCMLPAWVNYALDSTQLSKFSCITFTFGFYVSLFIQAWMLILVTLERYG SLVWIAPITRNKAIANCVLFWLVSIFLAAPYYSFRNESNEHQCIMRNYTWSVGETWHIAL DFLITLITFIMPVTIVLALSFKMARWSTFGYRNLTSRTSLILILILTVAAGFWGPFHLFM FIENVAGQIYHIQKDCWYLQLRHLCSLMTETLVFLRSVFNPYIYMIISYKFRQQVRSLLK RTQYDALDTTQLAETMQLKAKGVPVSDPAPHDCECFL 337
12 Rh214 Q2FA83 MNSSQHNISVFLSIGAGPVITGYTCVFLFGILGHFYLYWKNHQRRHRTNSFSDVLFRHLM ITEEVFTLTVPVWAYHLTTHGNLPGSWCRSLTFVFYLTVFARAFFYLLLIWDRYSVIICR HPLPVNLNYSQVIGLSVWLVAVLSASPFSIFNGSVKQCLGNMGSIPSESSAVLNLEVHLC SFWLPLIMSANCYYQAKRRASPDQLHELYRCSLLITIITTYAIVWFPFHLALLIDALISI SHVEPSSALHWASIVVTCKSFTFVYAGISPLVYFTCCPTVRRELLMSLRPFFTWISSKTR RGYAPIKTQPLNIPDEPIDNKSPHLLNE 328
13 Rh211 I3WF85 MLRQSYRYASGPAVRRTLGALKDLFSHQESQSSLRILVSLKAECRVSVPISAPPGWRMVF ATFPSVFGEDTPCQGPGSPWSKLICCEEPLEVLGVLQYWPGRRNEDDGDSSDEDSEDEYC DDSCLYVDDLLPPSKSKRVVLMGRYESLWVLDRDQNVLYFLASGLDDFARHGLLHCESIY SGKFRMPMLTTQPDDVISHLRMNDYSLCQLQRAMARYRGQCIPLRTPGEMTRPMLICAEA DDLKSCWPFLCMDNLMFEKLMQFFKDRLCCGVLIFGVVGEVLPSGVFHAEWVILMDAFGE LFYFDVYRRDVWRLADDIDSLLTMGLLKIYQAGRRFSLALSDAERLEMPPHCPHRTYQFW DRYLYMDRGMGHKHQETRFQWLVRRDRFCRLNPGGCYSRNSHHEVSGAADGSWEPHVRCD FPQATEVEAAHNFWRRLSDYVHSKEVKQGVRCYSIWNQMNPVLERAIVNLRQSMSAEGHA SEPESASASNDAKPAMLYKKPQVPESDDDDLLEIDGGGARAQAASLSSPSRSVETDARPH TDSSSEEGGDEDGGEDVTCDYYTQVLIHRAAKAAILEGCPYPRPAVPRPGSYLPPWL 597
14 Rh209 A0A1L6Z359 MTEFSDRPVDELQFYRQVLIDFRDLFFCLDAPQIEHYVWRYRGRRLCLGPPQGWYVELQR DQQLVQAQHAARKLICCNEPLCALGYALKLIPEPHRDNDRDYLQTDFVICMGRFCRIYAF DPRENYMVLVAHHLEELAKYGVLRSEFIYRDSVHNQLRRLSPTLIRSGPRSIRTMHILFL NETTPDSFYVTADRIVDHDVKLHTPGYGTVIMRLMKTVTELRTVWPFSSLTETEAKRWWW GIRANLATPWYLLGVTGRPRLGRSFVAEVMVVLDWFGAVYAIQLDEPNHNLRRVANTLTE FFRMGLLKLVFGYRRFEPERQRKIRMEHQCICPHVEEREMDRRHELLAPFEREERRQRFV QQHYDWLCLTERFDPRQGAWERLDPNVLVLHRYDTVQQTYVLESDIVGVEAAEREAASHQ EDTGPRLHCLVTTKSSTRERTTERVLAALVYQSRLVTYTDPFPFKSLTGSREFVPI 476
15 Rh204 A0A1L6Z333 MWRTRWEDGAPSFTRPDDFPYCHARYDTYLRVMADFKDLFLRQANIDSVRVWVRERIDHV LCLGIPCNWFVHVRPGSHMPELRDQLLDDITCCRERMAVIGKCIMWVQDRFVETELIMCM ASDTKMYIYEPSQDILILAAEHLDELARYGLLHAECVYRQFYTPYATRVPHDVVSAMLTQ AHDADSLAQCVGAYHNRDVNLHTPGRHADTLKLLANFGCLSDLWPFEAIDPYHLAECQMY LSLRLRCRWYIMGAVGTYRLGGFFEVSSVVIFDRFGRIYTVIVRPYTDRTSHVCLAPGNV YRVADTLSEFFKGGLMKLYVRRRHEHHLRTIARLERGVRCIHLDETYRLHFTAFDHGVSR DFVRQYRWLCRPDRFRADMITTWDGWDAFTIWHTRVLRGDFVDRRRPHENRDEGAPPRRR RALFNPEDLPPPPPPPPPPSPPQQQPQPSPPPPQQQQHEQQMPAEEVAAAAVAQQEVPAP QPPEAPAFQVPALPAPALQAPPPPPIPRMQDDFDDVHEDDIEVIGRDNEGFQMEEDEEED DDWEDLGFDLDEDSMYDLKDIDAWHAERQAAQADRWRLGQKLLDAYHTEVDVTEPEVEAR RVHLNRDLSPDWINSFDLRAFFQ 623
16 Rh203 I3WF82 MTLLSRSAAEAWGTYLKQRDERPEDVIRCDYGVFSLRNLVFQRCLTMLQGVYLRQYDQPC LREYIKKNSGTIIPLRNPCSWFLVLRSGIDIPQVETRSFDEYLCCKEKLEALGILGVQLR DGSDRKKIQETTCVVLLGSYGFVYVYDWDSDGLFQIGTSLKELAHHGLLTCESVYRHPQT PFSTTEPRFQVEKLLCLDPTDARGLAKTAEEFHGVNVVVKTPGRSEADPLLLLGTVEKLR QMYPFAKMRADNFSNLIKYINQRMCCRWYVLGVTGRYANFGILLTCGIILLDECGVCYVL RIDESDVFRLADNIQMLFRCGFLKLRGITRFDRGLRGEARLESECYCYHGARKQDLSWCS MVNTVTAEQLCGAYDWLTRSNRAHDKIPTSCCWGRSDLMPTGVLQENQNWCFPWSSVTVL QGPQSGAWQENDELTEKTSDGTVMFRVDRGFSPRTVKFEGESDDYTEEEEDDDNQSEETP QHQPVVIVSQETNGSVDSYDDESESSLSSDTHDPPPPDIMAIIQKEWQNEEPVTNERELL LRRARRAKHMKKWHCSLERVSIYDPLNANIHCFD 574
17 Rh202 (RhUS21) Q2FA94 MQLSDEVRVVRSVFLLRVYILLWFQSLLFLSICALCWLVLPDRLEHVVCNMRMMLFCLML SVICLGILNWAEPQFPKNLFVSLIYTLLTAVAVTTSGFQFGNRSAVYAMLSTVLLFIVLS ISTYRFARDVEFYRPLVTASSALIIILASIFYYFPDEVGEMVVMFGGLAVIVASVICDTQ DTLHRIEYESYIPAALCLYMDLMYLFVTLLYFVSTPNSQEVSRVVYKS 228
18 Rh201 (RhUS20) Q2FA95 MVEQENAENNMESAPSDSSPLMVTPEEAVVWFKNFVVWLRVYGVYTFALTCTFAIASLIW LGYPQNQNLCVNNHSTVLTLLVPLTCMVTSYLLGARHPSNLTVLFFYICVNLVPTILFNI CSEGYVIVTAYIMSVATFIAFTGLTFIAGLNYGRWKWIIGMYIIVLALFLTSTAFQSAPW HTKLTNSISAFSISFFAFILAYDTYVVIYQSSFMYCIRGGIRLYVDTIAIFLVIIFMMSM PKWVEHAKNSTLT 253
19 Rh200 I3WF79 MGAVFNNETDMEDELRLLGRRIMFWMQVCMAIVLQLASTVIVSLIIWIVSPSSFREFCNI IPRYSILSLFVPMLSLFILHVWGQCRCMHQLVFIVIYMFPNATALIMMATCRSFQAIFMA SLLPLIIMMFNLGLICFTRLRMGVSRLHRWFFPVMLMNSALMVLALIALPASDTLWVGGY IALLLTFVIGLSIHDMTIIGKQELFEDATLVLIIRIYVETLIMYIIGLLIVDPDFWRNTA SSPFDLDFSLGRWWAAEVNLN 261
20 Rh199 (RhUS18) Q2FA97 MSLQEPLDSELAESWMHQNLLEWIDKFRSIVSVYSNTLFEVTATLSVCALFWFSFPSVTE LCLLCAVPTGAMLIPILCLGLACCYQKELINRSGSATFMCMLIETGTCVMTGFCCPRQNL GLGLSLTAVVIVLCNSIVFYAGRNAVRWRMFFVVYGWCMLCFVFFLTFAKAAIIYKIFTV MYMCLISAVSYLLVHQLLLIIYPTSSELILTEAAELARSLAVYTAIIALFNIISMMFSVN QWMGNMIQQMNHTEPSWAWFLLQNSP 266
21 Rh198 A0A1L6Z2M1 MTGHQVMRLIKKTRIQNQSLKLSHRCCLFSLHLYRTVSLQVSCTSVIGGLMILAAPYVKI PQSICQTGFLPALSLLIPNACLTILHAKKQHSNSWTVLTIYTLVTATAVVLANLCVDITL VTWSGLLAGILFVTCTGLACLGDLHYRRWRTLGLIFFLILTITLVALSLQPLSLPNKILL GYYVIVLAFMLGVTVFDTSQLSKVSSSQETCVLGLCLYEDLIYCYLLVLLILTTESSLER LTSWMQHFSPSSTQNETRPTVNSAAINHGFENGD 274
22 Rh197 A0A1L6Z2L3 MVSKMVTKLTNHVIWLNRSIHVWSVYGWLAFQVSITVLVYGLVRCQQYLFDTCAQEPVRQ IMITSPALVFIQESYINHVIRKGSLWKNCGVALFCVIHIAFSHVWFSGCVATWTVIQSWI ATFCLFILMIYVSDGSNWKPFIERQVLSDMLCAGALAANCFVHSVTQPSVTLWWIAQTLY IIGTVGFMNAMCLQLSNVRRQQRSNERAMSISLLLYCIFHLVHYNNVIMWSFPWKAEDPW L 241
23 Rh195 A0A1L6Z2K3 MERSSVASISWLQRTNCIFKIYGCFTLAVVATVLVYGLARFTFPMLYNNATNCRVDPAPS VLFLIPVVLFMVSHLLEESVDQTSSWIYSVTLTCLSTSVFHLCTNDHTIWQTFVLSLLLF CTYGIPGICLHWIRPLAGCFITSFAVAFSLIALFSKNLSIILRATGYAIFSLGFVLLIPT QFYLVHRRPERIKSSSLQLYTLFIVLYQVSIFCWTKDIWSANVHNMFSVFRSSTLSAHVP KS 242
24 Rh194 Q2FAA3 MPFAPRLQPFTVHRPPAPMIQLDLDERSSLSWLRQHLPLASVYLCLLFVIAVCICSYGAF KSQFHCMVFNTEICRMEPAFILIIVPVLLMFVWNMFDHRQDDMIHMGNGLLYIVVFACIG STLISFCTDGITAGLSLLFTATFFLTCSGLALWSSRPLPSKCRYIATLVSTFLLLLFYFG QLSHSVMRNGLSIILHGSMGIIIWENIYITKFNLTMKHVVSACIVYVDILIVMYYMYVYL LTPSLWTLDPHKMLTGVSQLWNGSFNRTFCSPSSVYG 277
25 Rh192 (RhUS13) Q2FAA5 MESFRFQVRFNESTAWIQRFKILVQVYSYFIFEFTVTAVFTLYIWFSYPQWHNTCQNDPA PILAILLPVICLACLIIRWERQPSDLFTMTLYVVWVTLSITVFGFCGEVSKALAAHVISV ALFTLTTTAAFFDNFDENRYDRPVRRYAMILTLGASSLVALLAIAASNPTTVTHIMLSTY TVFLDLFMILFFWMTQRHRKHLWEKQIIQGSLTLYVSYYALFQVTFLMLIPNIWHVPFNR VFSSFSWNNAQVKT 254
26 Rh190 A0A1L6Z230 MGYQTTARHQDNDDVEEVMRWMRRFVWLVRVYTAMAIQLAITMGLCLLCIMSSWRIQTPY LKDTLPIWMMIVPTVLRFNLRRKTTYRLSVWPAAVVYTALNTWALVIWSMCLERTVLWQA YVFSLVLELSCTVFACVLASTRPRGRLVVACLVLALPLFCAIVYYQSWTPAQKWIAVLTA VIVDLITLALLHDILMVLCYNPRSLFDRHAIRAALLLYVDQVLVLMMAIVPLTADKWYPE YFSSTFPEQPVV 252
27 Rh189 A0A1L6Z332 MARFLKVHIFWIYDKEACRHQPGHCYVTKLHKNASSWCCCRKQHQDQAIATMKLLNLFVL SGFIMYVAWIDTLILSVSPPPHPPMFEIDPNNMNTDGKVSDSFLMKNVPLPSLSATKLVS DYHLENPRSQCHLINDNYLDAMWTYSGNATAPDLYLSADVITKFSLEKLPEPQNVSTEYE QRYILKNIQLTKHVTAINLYVHPCAYCDAHLITCEPKLRISWFPFWASIDQLDRLIFEGR HLHAYWGLFLMFIRWSFMLCMLIQMHWSLTGRSYWFYGIWE 281
28 Rh188 Q2FAA9 MRLIVLGLLAVLPIVIVADTFYMEDAINSIRAYQNLSAAEKAQYERELDRWYLKMKLRFY DELDAMDRPNSTECYRWLATRWMFYTYDKLNGAAWSFPRYPCPYADDQSSQSSESYETES SCSA 124
29 Rh187 A0A1L6Z2L2 MRLLVVFLLAYFWIQDKAIADESDIEDANATCTITGGILDVTWCMMGKALPNETTVFPYY ESRENSQRKRCLPMPNTTFSSNDTICLTTRTPAPADLGRILLKECRECTCAIPCYPETIA SWDFLFNGDFQRLVYEGRYATIAWLWCMDIMLGTAILLVVVAMGCAIGECYWKCFTEPRI PYRPLSSKED 190
30 Rh186 A0A1L6Z360 MPRSPKMYCYHLPRALLFTCLLLIVPAERCNKICQQRRTYKPRSGIPDRRIYGYTELDPE CKIEDGRLHVNGIVLGDFPDPTWLHVYLRNYYDGKLMFAFSTNLDHPLVIMNDTMYRHSI HPMQLLEEAKTYIRDHDIIHHARLEHASRLRYQFHLPVSYMFKEVVIQVDHYYKPLFIKC VPEHELTQIVNFYLREYQEFHNSYRGKLYWICMGIVYVAVAELTINFLYNHVQV 234
31 Rh185 A0A1L6Z319 MKPLCGSCGSNENVVIGSLLCLLVLSGVTSAWRNDSNTLQKQDGNMEKTCDRVPQPDNGL HQKEAGRHCPFMDQGPACDAFMRRYQRAIRILGCDTELHFHHGHALNIRGLFGCPKATPK GIVFLLERYGGATLMLYLIMILLSLMLTALMLYVIEDLDRVRCLRRCGSH 170
32 Rh184 (US3 protein) Q8JKF8 MKILVTLGLLSLLLAIDASPLPLSSSYELLHSRCHVKGGKMTATFTVRSDFAKLQSVEIV THDRDNIRRSHEKQTHSTLNTRTWEVHEAVSPTIYRVDLRMYHDHGLAKTFVCYVNEVQV EIDHTSIFWYAERVSRHNDWILLARLAFYVAVGCAIVTFIAAKFSVHVRMFGEVSINNKV 180
33 Rh182 (US2 protein) Q8JKF7 MAVSLAILVLGGVALQLGLTFGWDFPMPVLTEEELAARRALYTVQQTACYLEGGKLFMTG YITGNIDSYFVQVVVYRDKGIEDLQFFEKDMKLSSDKLEYDLRYYEIDWTTTKVEMRFSL NMSDIIWVTCEPHVKPDFLTHNYLWTFCRAIWFRDWWHVCWCTTVCTLHLMICALSIIWH VFPEDTLKIYFPAFMF 196
34 Rh181 A0A1L6Z322 MEPVVSCGLVGHMPMRELAWRRVADDSHDLWCACMDWKAHIEYVVPLAEDILPRPESWPA QVEAQWRLQIKGAHDVWCQCGDWRGHALRSRSLTLDSDSSRSSRSSRSSTCSYVSVASCP AAILEYPGAADEASWWKRVKGRFRMRGWWERWLQRRRQRAAEKETTQPSSA 171
35 Rh179 A0A1L6Z331 MPSTIPICTSPEAPPKPPRLHKQRIQSTDCQRPSKAGSDKEESPSNPHSTSNPTPKPPSK PLSHPAPEPTQNPQRKRQKTVLKRPSHPPPPPPTQSAVIPTVCVSPPPSAPPSKPPPVPP KRRPELHLPLKGPRMVSIELPCLTGSGSPTYDYPVNSARTLL 162
36 Rh178 I3WF65 MLSYMYVMCTFFRFTFAFTVTTLFVAFLLALTNEFCRCCGFSLRQRTRYLAVQRLLPMSA TYRLCKRVFRAVSVPVYALISSFSAVSDNPTPSAQLHANDNHTAFTEGPNRALRTRSLSP RSACHHPVHTHTSYTTADSSSSSSTFHSVLLHHATAAAQGSRLSRPPRPPRHHDNNDSAL SGTGARRKLASRHRSDYHDSSPRPARSPPKAL 212
37 Rh176 Q2FAC6 MDTVLWIMDFTSRFFQIALCVVFLLGLLMAFLLFLSTKCCIWLPLRRHRNRKSLWPRRLQ RLTAKNPCPSDANAAVAQAASGVSAMSSASPPSPPSSPAVQCDDTQKPTTRVCHANRQCT DLATLLKRHNKEATKKPSLSKRLLSFRCRKQSSGVKTPAAGANNCCQQKGGTEGSQVLAL STARPPLPPRPPRPPPPRRIPPRRTATTTSNSP 213
38 Rh174 A0A1L6Z309 MMQPVSHKHAHALILLMMWPSGTSGEALRCASKDYTSNTDMKYQLPINMTKVVSGPTKNE TLSGPYTVTCIFVSGECTRGIYFTACDQNATTQVYMYKNHAPIFPNDESKTSASNTNGFT MRWPVSPHAPGTYDCFSYDNVTNIMNITQRTQVTPMGITYASKHSTNQSVYNVSCSFNST FPGTVTLIVQGAVNATVIHNETVKLCGQDLYWNYLVLTSGGTPTFQCTNKATNCLLSGYS RLWSNTTSTPGPPIPILHNCSTYSHPWWTTARPVTTPSVSTTQLTSLSISASTSFTYNVS LVVYEAQYASRELHGLWILVVLIICAAVACWLRLPQAVVQTFRKCVASLQRKHNVYTNV 359
39 Rh173 A0A1L6Z325 MHFRISYLIKDRTIYIFIAILSRYAASNNTSTVTTTTNATSTSISTSTISTTNTSVISTI SSTAPSTSETTANVSTPTQTQNTVTSSSTVNASTTDTSITTNVSTLSATTITSPNISETS NSTNGNTTITISSSAITTPTTTRNTSTTPINSTVNTTTTRTSTAAVLGYTLVKVNATVGE TVNLTATNFSITTHSHTYWVLMYNNSKVMTEHELCRTSGSHQTKHHYGTLCYNCSKSTLM LYNVTHNDSRRYVLKTQDNSPKPEAFDLTVTSGNGTSYPNSTPDFCTFVSSAPPTSSTTV NVYLQDVAAPATHAVWALALVITVVVVLMFGQGKMKRIKYYRQRHPEDTERLVVRYRPER KRLTTGYEQMYISS 374
40 Rh172 A0A1L6Z350 MTTSSYRNMNATSPSTNNSAGSVLDMWPLGVLVCGAGGMTSLVGLIYLIYDWPFTCGLCY EVCCDCGPWCRCRHDCSHCCQKDRYEVRRRSHWSRRHQEDEANQRVEWEVVNTWDPSANN NQDDKTEVQVAPPRPTVLCGPVCATTEKVFVETELTSSAVYTPQVHKYRAVLVSEL 176
41 Rh171 I3WF36 MDTATIVLLSIGIPAAIIFDILIILYRDRVCPYIWNFFSRLCTRFNCSLKKPDEETKRDA STGDEDETMCVCSLWCASLWAGFCQCVSRCVAFTGRCCSQISARNKLTKENLEFYFPCCF TCCHWLSAKLYPTEPPQSRRGQPKDKKQTEVEFVTVDLEGFECELPTLDESPRAQTHTDV AEADNAETQALIHKPPSKHSVSETPDTEEEATRTPTPDSVPDSVPEPDSDPEPCPAPAPT PEPNADIPAAAGVTPEVALLIQSAVEAAVKAALLNAPKS 279
42 Rh170 Q2FAD3 MTCVTIHDNMNQCQDTACSTLDLQHLEPHPRNEHRCAIVRMLSTVYRTLKGWMHRFLSIF RRKRKQSQCTQNTATINSMVKTALSYSTSASGHTMIDMEVDLCAFLTENTYTLQSCTFSE ELTTLLAEKVQSVLFSVQAINPYQSSAEAKVLVSNCPAALAEIMDDEGFSEIMNSKFQAA FEHVLECA 188
43 Rh169 A0A1L6Z314 MRLLASVRVAFWKLKKCLRGTRSREHEPCPAKPIMVSRAVQTELTYSTPAAKHTHIEVHV DVSRIPSEKAGAVDLQQLKDQLTSLIDAGLRNVLDGVMLTGTLKTAIYVEVICFSYPIIM TGVIDTDNFSSTMANRFQKITGDAVQIAYDGLPRHARGTPNKFQKHMIDMYCASRPCQIH SKRCHSP 187
44 Rh168 Q2FAD6 MLTNQEDKIIVGLVLSIAIVAILLFLYLLIFHVRRVGSVCKDIFTCYCFRSLASRIRGEK FDSEYRNVYLRENLKRFAQDYKRVLIMCPPASGKKIPTNGVSIEMDEAVNTQSEKIVTAA LPTIPTNRSLSHSDTETERIYSNCKKVTLMMDGEYAVITEVPNTTPDPPSSSPYATIFAT DMMQIPNVTPEMAAVIETAVRSTLQMLMKMQPQVSSEK 218
45 Rh167 A0A1L6Z203 MEMVVVILCAIGVGIMGTGLLILTLVYPMHMMAVCQGVFTCPWLGILLGGCRKRCRSKNS DPDLEIGLLKSYLKGEEIRRQAEGVLMEIDYLKELKTKKPRISKPPRSRSADGTQEPMSS IQEEQTDALDEDVFEVSSDAAPILGSEAPVAMQTVVSTQPVSDSSQQ 167
46 Rh166 (RhUL166) R4UY11 MSSEDTELYALLAVIVICTILTILGIVYICYYPREAKAAIMDMLTCACVVSCYRYGCDCQ KFRTLTSLNSGELFTIGGWITDRFRRWWHGNAPPTDPVQYYSPPREGDNEGLVPEVQNVQ PVDTVVTIEGNQPVTRVVSKQPLLTQAAAPQTPAQTHEEIQECLEVAISSATLE 174
47 Rh165 A0A1L6Z326 MDSIIQAQLLTAIFVVLLIFNVLASIYLCYYPRHACATLQYVFTCSCFLSWYRYGCNCKD FRSLRVLENDEPETALEIIVRICEEWWYGPKGPPDPVQYYSPPTYESHEQQPHELPRVEI TSNSSGDRAAETVVDIENHTPMV 143
48 Rh164.1 I3WFD4 MEIPIVVATILSFLIFMLIIISICCTKPWKRLRYFTLPAIVYRKKQADESSLTWDPTSGD TMMILSSRTAQPISS 75
49 Rh164 (RhUL141) R4V8I1 MSYTVRFRKGFGRVSEEAETVQLLAEGQEGADSADAESASKRTIHDGPLRVKACTPVSAP RAAMWVRRAMVAITIVMVSLTPRVRGGSIDHTMWDECYEHNSPAPLIMPIGSQVTVPCAF LPHSWPMVSIRARFCQSEYGGYELKINATNGTVVDDDLTYRLINASWKFHDLAISHYVTL TMNISDNTTGMFDCVLRNATHGFLMTRFTIVTQIETLHRPGDPDCAPKLGFHADGKKIWS AEYNEWQRHQCGTFYGFDRLYYYLAASNQSNTKPPCPPSEPDRCWPVLQQYVLDGDCFRS QNFRREPPLPTEKTPVPIFVIDWQWVSLGLTMMVIGGVCLGLVLVVRCACGEMCRNRERF QKKMNAYRPMSTHFMRPPGYEELYSVVDDESDSGYFEKEDRSESYNDLVDENVYDEVAVP PLYSKIKRRL 430
50 Rh163 (UL144) D5KB33 MLLLSVIWAAVLASRSAAPACKQDEYAVGSECCPKCGKGYRVKTNCSETTGTVCEPCPAG SYNDKRETICTQCDTCNSSSIAVNRCNTTHNVRCRLANSSTASAHVDSGQYQQAGNHSVL PEDDAARDWWFLLIFVIFLFSIILLALGCRLILVNTTYGKMLTAYMYEKIA 171
51 Rh162 (RhUL145) (UL145) A7LBI1 MVFYQYHNAVQLLSARSRDGPGRWERLTHHASCADDHGACTVLMATSQKRSLVLRRHSAI TAVTLRLIPSKILKKLEESDWIPGAWIASETFPTSDAVSGL 101
52 Truncated Rh161 A0A1L6Z340 MRSLVLLCIVNMFFVAVQGIGIAKEKHCPCRNTNKLTGIPPNADCLWLHRLGSPCGDEAV AHFPPTFLRNGKPQTPLCLDYAFVNRTIPNGEGIYCVIRHVNNTREYVPNCEYCNKRKLL RAGST 125
53 Rh161.1 A7LCG1 MRVYVACVLLCVYAHGLAAEQRCQCIGKKYNRIPRKAICLSIEHAGPRCEVTEAVASFNP IHNRPPMCLDYNNIRNIFPATPGTWCRVGKSLIKVNDKNCEICNRFVTLE 110
54 Rh158.3 A0A1L6Z301 MNRAIFNPRVLGVALLLMTLIAYHQTEAELRCQCLHVTRGIRPSNIKDITITKPNAGCDR KEIIATLKNGKQVCLDPEAPMMKKLLSKVPEGKYPSFWEQYKEHFLKMFTE 111
55 Rh158.2 A0A1L6Z321 MKFNKLTCNIFIVTLVVMLLVSNAVFAEHPRCLCLRTTKGIHPKHIKTVEIKEPRSECNK IEIIAHLKNGVEVCLDPESAMGKKLIEKYQKQYEQ 95
56 Rh158.1 A0A1L6Z2Z6 MSNLRVTIGAIFFICIMLSGFSDSWGSELRCRCVKYYYGIPWTATCVYLEPRSIACNHHE LIVYDGSIKKTCVRVANPSAFKNVNKVAWFTVKREGQGNQLKLKRHNGSCSVVH 114
57 Rh158 A0A1L6Z317 MQHFDFYTSFINVTFAIFLFSCLTVSNGTKTEYCECVNVTLFTFIPRNTLYLQPLAPDEN CTKQEVIAVLQNNTRTCLNPNALAIRVFFHKLFFRITKNEDGLYEVINTRLELPSWNITR KYYRQYLQRKVNSENAKILSRMIL 144
58 Rh159 A0A1L6Z2Z2 MAYNSFLLGCLTIALLLHGLPTSTIAKDMAGHVHVHMLNAPEDTASTSAPIIQLANGFIT CRKFTELGWALCTSWDDMECFPFWRRTFSETKNITVLSDDPYYAGVVLTVRTLIGDSLEL TSYLGVRPSIANVGYYVMYLSYAKELPAKFTHKDVDYVRFAIYLHTEIDAHQTPDNDFIF TFATPGTFETTDLMSSFVIGTGDGQNGTLNFTTVDGGKHHYNNVELSSEMKGNCVHHSAI IRNVASSQSWVSFDFSLYWRRTKIAYSYVQYYFPKPLHSPESIGPAWQRIYHCFSLLTQL RYGTVAITVVLIFLIGALLKRSREAH 326
59 Rh160 A0A1L6Z306 MTNNTTANISTTVTTSTAASNITGVITNVTTVPTTTTTAEPGSVLTELLGIIIYCASTVA LLCLLLVLVAALYSTCHTRNKIKTKYSEQEAAKLIKSGRRSSPSSKKSRPNKGDYQQLWQ SQSETDSTSDDDADNNVLYFDKKGNLTSFVNPQYEHRSSMMIESQADDDENIHYYMSIYD ELAAEAMADPSESWEMPKVLQVSTREVTLKEPEYDN 216
60 Rh157.6 A0A1L6Z324 MDACRVFITVTVCVLFCAVTVQGGICSVDFGNSYRTHRPDGYWDICSPRIPDDRRNKILE RIINATVSYHYATSHSHDDVSLLKQINVTDFTYLVNSIQVRPNQVHESLNRELSGPDPKN SNKPLEKIGLQHYLGYQQLITFAASGTHTAQSRILTVAIRLPLEKLPKQQ 170
61 Rh157.4 A0A1L6Z2Z4 MNRYKQLHLYVLLTILHHGLSDFANKNISLNGFCPMYPSPRQKFDMFTSYETYHTGEECD NSTLYVFKNIYGQYLIEKPSSWSDRLVKYLSGQKSTVFGKFAQMAATPTKVLNITEQEKR DYANHMIYTRIATIRFIVKDGIDVAHCQMRVTTWAKAESTFISFKVKIEVSNAYKRPSSI CTRPNLVVPKVELLKPTAIPKTTKRTTRSTSAKPIPPPASLKPTAIPKTTKRTTRSTSAK PIPPPASPAKQVTTKTPATKPTTRKPTTTKPTSAKPAAAKPAKAAKPKKATKSPAKPPQL AKHFQYTRRTSYPLGRFYSSNYIRRKFFS 329
62 Rh157.5 A0A1L6Z318 MFVIYIVCIILLLPTNLFATSRSCCTLINVNYTPQDCYDFKICSNRTVSLTCRVGQICYP QYPANSNLSIQKDVIMPLASNLTRIRIYTNKATCLHNPVFVNSDGSLRCATVHNNTENVL GVAHKLDYTWIDNTPPQRPFMDFNWFLEKLLEYGRNDTYHNGFLRSMIAVNGTHASSDDV FNTTQLPQVNVTGDTSASYTAPPTPVAATIDLDSYPYEEDIDGLLGTIHMVEYGNHTRKL IVCGPYKG 248
63 Rh156.2 A0A1L6Z2Y8 MVTGVYWNMRERLSIYCICLYLVAQATFILSSSASPTGTSSLSSSTTKGSGTEPLTSSAT KLITAQPGSAVAVVLAAQYKVESGSSSSVILPTVLAASGMVVLVILLIGLNLSSTFWSQQ VDEESELEEGPSRLHTDTTFISASTVDLCA 150
64 Rh156 A0A1L6Z2Z3 MDSRKRKPEDETTGQTEEGDPEEGTSGGPSTGPSPPKQARKEMALQQAVDLLEKMLADEE KKLTEFNLGDPLFEVTGDDPIKTLEEIIQEGDDVVGAHQLVVKQIKLRVQRNRRLADEII REQLTDIRKVFSDKFNKLEQGIQNSYVLLEKLKDPFKNMRCLLEVANEQFNDTPVPPQYK EKFMVCLKEIVQYAVNSSINLEKFIMSKIKTKKGDIKDRVAYTCMKYLIMAMQGTGGPKA INNEEHAKLFVKQLSNYDDLTTANHDGLELIKKLDKEQKEIAFHVSSFDHLITTLGMALY KEGHQKNDEAMLGMHTPITMLSDQVRVLILYLIDEIIHAIHTNSNQSNDELIDGLKPKAR IVINEFHATLMMGTEKMRFYSLSELREIVNDKLNEDRFPVVSGVLPENVPGADIPLASVI IHSDTEDEEEQDSDADEEEQESETDEEEQETETGDEGAETQAEETEEGTDETDIEGTESE TQIGSEAQPEAAESETQVEQTEGETEAETPQETEEGDEESEDLQMTVIKYAKPHVKEEGG AGPSSKSKHHMQTRSKTDK 559
65 Rh156 A0A1L6Z307 MDSRKRKPEDETTGQTEEGDPEEGTSGGPSTGPSPPKQARKEMALQQAVDLLEKMLADEE KKLTEFNLGDPLFEVTGDDPIKTLEEIIQEGDDVVGAHQLVGPPPPTPLDILAQAVSQAG IDSSSAGVTAPIPSSMITTTAPTIAPTTTAIQVPGMQITASLQGTPKPKSKPKPKIPAPP SAAIAAPAPSSSTTTSNTSSTNPAVCKPTDSMSQRKKSRKTQHPMKVIIKPPSPPTCMLK PSEIKQEGESFIRYKGQDIQPTSGCIVISDSEEEEDTEPGVSARATSEQQGVQLKITTKM SGASGQIPMDSSSSSSSDSECCDECAGDHFSSASTITSPVSPIHTPPPAPMIPSTSKGKT PKAPRTKSTKRLTPLDCERVRSAMKEKAGTVFKNPTVETKRGRVRADEVSRMFRATTRSL EYKNLPFLTTNVHQLMAEAVNACKTMQVNHRGIMVTYTRTHEVKEAVDVARVKLGKIPNL SISTPFLVEHTMPNVYPAEVVRKTAEACASGIKQAWDLKAVQPHDMCPRSSDYRNMIVHA ATPVDFLGSLQVLVPLVQRFPKQVAIRIFTNENSNSFMLPIYDQAAKMYAVGQFEETKDE DLANLSMAIEKAIEDMNQESSQ 622
66 Rh155 I3WEZ4 MLLGLAIVLLTSVVVSVCGVQTPDMCWDRNHMKVKCLLRQLDTRLYWFMNDTKRVWAFDY DSQTPLSVPYRVEVRGSLWSSESAVILRMPPYPMTTVGLLLKMDEDREGVLCVGVVPKKR YLNPCGWDSDLSLWYCVCVLLTVGVMIAGILKLDYDTTRHLTDYKSWLSRRTRYFEPAVK RW 182
67 Rh154 A0A1L6Z308 MLRFYHAVYLGIVCMVIIMTVVYSLPFYSGDPLAPHVKVAYIYYNASNLTIYCNTSGRHS RFLAGGIMITTKYNTTFLKGGYHGYDRHPRPLYLKFVKVLDTAPYRFYLNSTVTCWGSNG TYGVRSFMVTKITNTSDKDAIVLVNDTDLVETPDAALNWWPRSQQNRVVMIVLLAQLVFV IFIINACLIWSCKFKRHN 198
68 Rh152/Rh151 A0A1L6Z2Y2 MLGTGHVLALAAAVLIAQQVIGGTSTTTAANTTSTTTAPSTSTVTSSPTSVTTSVASSSA TASSVTSSSAAASTTSGTVTSTSKSSTDSSTQTTSSNTTTAPATTESATTSSNASENTTE NSTATTNNTTSDNVTTDTSTVATSISTTVTAATTTPPRIPDISVTCESAYSYNYLVLQTT CQIHNMSSLQNVSRDLIAIECFEQVGCDGNLTSIGSVTTSNTSKGMLYNISTQSFTMYTQ APNVTTQYTCKFIATGQTLNTSWEFLVLPIKAVFASPTNDSMIQLRVLVNDHPCTNETVY SSSKAFVYFGNTNHSSHKVQNITRHNQSLWEYIFHFTNHDLPNTAHMKILLGDRYSVSTH VFIKRDPDEWPIIGTLGYIVLAFLLFMLFALLYITYVLMRQRNPWAYRRLDEEKPYPVPY FKQW 424
69 Rh150 A0A1L6Z2Z7 MFSNINIVYTSQRVSKSLAPANKRKTHRTIVVVPQQRFLRIPPDNQDVNHVRIIHPPPSY DARQPPTPPKLTKSLYPYGTSLIRRYARDVKQRKRLIVFNTTSPAAEDSHASSGSGKKMD QDVIDDFLADTFQRDASVANNSSNDDMYIDDLSLSLSPSSSPEPSPSTSTASSETTSIPT IDLMNHRVLLETDRETTDLNATPYLLPNDYRFAPSCVIKYRYIFEELSRVSRVYDSTAIQ LQVSAACGNAFQNLKTTLLKLHNITVLSGSQIITQTVPHTPQAVAAFKYCHNSSDNVLDT VRSVIPRAVSYHETGVHQLYVSGATKKDLINAATLCAAVAEKQPDIFNINICALSYPSIA APHLPLYNYFTEFQPQACDGWQ 382
70 Envelope glycoprotein L, gL I3WEZ6 MWRLLVSAAVLVTLVFAETLPQNLTCLELTRRCFTGETFSPEDDSWAKPLIKVNHPDGNL SQLLRYTPLTKHAASTIPLDDTFMDFVALLHNNPAQLRTLLTLLKSDGAPTWMKIMQGYS ECGDTGSIYTCVDNVCRAYDLRYLTYSNSIFTENVLGFDFGHKGQFAALVVVRHEDIKMH RPVRIPVATRADRNGLQLFYALYNLVRELLVRHDLDTALIDRLDKYYLDIPDEWKQPLTN NPALLHNGLKAVDVGKHS 258
71 Rh146 (RhUL114) Q2FAG2 MALKQWMLENIPDNKACMLNHDEQTRLLSVSKEWLVFLNIPSHDLDLLRDTVDAVARARQ SDTVYPPPEHVHRWSYLCAPDNVYVVIVGQDPYCDGSASGVAFGTLPGQVAPPSLQNVYR ELCRTVAGFQRPIGGCIDDWCRRGVLLLNTVFTVVRGQPGSHRHLGWQVLSERVISRLSE CREHLVFMLWGAEAQTLECLINKSRHLILKAWHPSPKNTKSFLGNEHFVLANEYLRKHHE KTIDWRL 247
72 Rh144/Rh145 A0A1L6Z2X8 MEETTSTRTYWTFRGVSRVLHQSVNTGFDVRQSSFESATLVRCLDGEGTTTTLGKGWLCC TVVQNGDSNAPKGQPQQGFMSLDVTVEDILDNLFVRGMVVNNKNVSSVVGQGKSGDSSLL TVISEPDTLQVTFIRHHTKFSDSIAQASSSGASLSSGIPSSSSSVSASVPSTAALEERRA RAERHERKKHQHQQQQQQQANSVQDGAGQMRVSGGGDRDPRVLNRPKDRRSETDGSPLDK RPKTHHEPKTAAEHTPRHMPMEHNPTSDPVGFLNYSSHAPLTDHPGSDGALLQNETAGFG DAEERPEELGSRAPSPARGNSGTEAGADAGVRASTSATDDGGDDEHVTPSTSSGLSNRHL PPNSQASSAPLSPHPRSPHFEDIIQSLTRLINECGKGDRVDTPAPSRRTPECSDSHASPA ATSTAATAAAATTVPVCEAPRPVCEIRPYMVNTAAAPQPPPEPQQPAANRRTRGGARPRN GSRGGGGGRRGASTSGRRRRRNQDDESEDEILPGPSRRRSVPPSFAEDGLEIIDLAEEAA LAAASIASFFD 551
73 Interleukin-10-like protein (Rh143) Q9J4U4 MRRRRGSFDIIVAGAIGTLLMMAVVVLSAHDHEHKEVPPACDPVHGNLAGIFKELRATYA SIREGLQKKDTVYYTSLFNERVLHEMLSPMGCRVTNELMEHYLDGVLPRASHLDYDNSTL NGLHVFASSMQALYQHMLKCPALACTGKTPAWMYFLEVEHKLNPWRGTAKAAAEADLLLN YLETFLLQF 189
74 DNA replication helicase, EC 3.6.4.- Q2FAG8 MSMTVSSSRPVKYEDALILNLSSAAKIERIVDKVKSLSDVRFEPEDFSYQWFKSMSRVER SADQDVRVPCTDQWPFFPFRTLLVTGTAGAGKTSSIQVLAANLNCVITGTTVIAAQNLSA ILNRTRSAQVKTIYRVFGFNSKHVPLAEGGNDILKQYRICESRDENTIQRLQVNDLLTYW PVIADIMEKYLNMLERKASLEDVSEMCESNVIIIDECGLLLRHMLQVVVFFYYFYNAVCN TTLYRERRVPCIICVGSPTQTEALESRYDHITQNKNIRKGIDVLSALIQNKVLMEYCDIA NNWVMFINNKRCTDLDFSDLLKYMEFGIPLTEEHITYVDRFVKPPSSIRNPSYASDMTRL FLSHVEVQAYFKRLHEQIRQSERHRLFDLPVYCVVNNRAYQELCDLSDPLSGSPQPVDIW FRQNLTRIINYSQFVDHNLSNEILKETLRAEDTEEALETLLTLRITYIQGSSVGVNSKVR ACVVGYHGTFERFVEILQKDTFIERTPCEQAGYAYSLVSGLLFSAMYLFYSSPYTNEEVL RELGRIDLPIISSLCVDEKGVSEAGVSSGTHTQTRVAVSGGGGDDDEAMVLGMDEDTYDI PCMNEEVSDSDLLAQTSLYEDPFFGKYVKPPSISLLSFEETVQIYTTFRDIFLKRYHILQ RATGGRFAALPMVTYNRRNVVVKSNCQIVSQTGSFVGMLSHVSPAQTYTLEGYTTDNILS LPGGHRIHQEVAQRGLSRLVLKDALGFLFVLDVNVSRFVESTQGKSLHVCTTVDYGITSR TAMTIAKSQGLSLEKVAVDFGDHPKNLKMSHIYVAMSRVTDPEYLVMNVNPLRLPYEKNT TITPYICRALKDRRTMLIF 859
75 Portal protein I3WF17 MDLNHWYEKSSGSKRTSERDLTLSTIRSILAADERLRIKASSYLTGRDDDTVIDIFPTAQ TLSYIRLLHGFIGTCRGKSIHQVLRDPCVLRKQLLYGLCKTIFDTITVRQVADEWKIHST LFPYQALDDEDLENYLLVWSASVRQSVQTGVLGTLRDILYQFADNDDYGLYVDWYVTVGI IPLMDVKSKPAEIAQRAAFIRAAIHKSTETHPLAQDLLNSNLHLLQQVVTHLCGVRIVNS PELRIFKRIKSEKIEAQLKERTINRYIVTEPLAYERNQLFFTTPISHLHEEILRYDSLCR HQKICQLLNTYPVKAVTTSRHEMNCKRIVDMMEKHDRGSDAKKSIMKFLLNVSDSKSRIG IEDSVESFLQDLTPSLVDQSRLMPSRTPGGGPSASAPPVTNATQDRDIRDLFKKQMIKCL EEQIQAQVDEIQDLKSLNQAWESRVRELRDLLSRYARQRSAQTFEREPKLHHLSITEAVR KAQEVAFNPLAIEDNRVVANSFFSQFIPNTEKLENLLTELWENEYFRTFRMKRLVTAQGA EEAIVYSNYTVERVVIPYLFSVLSLSTLEPIPEEYLHLSFGEIVAAAYDDSKFRQYVELI CNREKARRRQMTRQPVVHRPSSDAERPSQQQDAGGPFRSSRHGHPDGARGIGSPY 655
76
77
78
79
80
81
82
83
84
85
86
87
88
89
90
91
92
93
94
95
96
97
98
99
100
101
102
103
104
105
106
107
108
109
110
111
112
113
114
115
116
117
118
119
120
121
122
123
124
125
126
127
128
129
130
131
132
133
134
135
136