Chershoee
id Protein Name UniProt ID Sequence Length
1 Protein UL30A R4N7E7 MACRDARWIRFVRLRTLWSVQPQPHVADLQDFSAFYRGLSESQQQEFEEEVELACRSQRV RDLRNARLLKKMDSLCQGG 79
2 Tegument protein UL24 Q8QS64 MEGGRGRYIVRVEDGEQTASESDASTARTTVETVYATVGASGRTPPVEFSDRHMTDLASL ALTAEFGLGCLEAYVRINNNHEIPVAWPPGWSLVLQEPEVDEEFKPEDVKAWSYYLCCET RLAFVGRIIGEPVLSPDQQKKTIAFLVSEDGYVFCYVREDDAVYFIARNLMEFARTGLRA VESLHCLRYLGSSLVKRYFRPLRRAWSLGFDAVARFIIRNHGELLPLTYPPGAELRLCNL KCFESCVDGGHLLRAIKESFGSRVIGLGTVNLKGEQTPFPYLRWPPERVPIVISYTGGVY ACDIRSEQYIRLGDNLCMFMCLGLNLLFENRRFSGHNGVHDRVPDCPKGRQHH 353
3 Envelope glycoprotein 24 G9VYW6 MALARDPAPSVCITVWLALVYSLMILAILLFVYRCVVGFDGDLVTRTLAVYHLCHSQRGP PLSCQHNTSTS 71
4 Protein US33A G9VYW8 MSFGFPERIEAAIRRRRPHCKRVRTGHPTNMMHFVVRQLMMYPRLIPFPLPFYTPRLEVR R 61
5 Protein UL150A G9VYW7 MTSPTPDLLANSGVRRRNTLKRTFSALSRSTDGASCCSTTASEEEQRRPTSPAATVVAAA PAPSAAPAGATAGAVNGTVAVIDVAGDAEDGLTQRLCTSTSSNGTAGVASEAVVSAPPLV SEKGGETTTGCKVVEQEERESPKNLWCTAFREAIWDVALLEVPRWAWQGWRRWRSQRGTS SFPVSFLAPSVLPPSPQSAAASVAASLGSAVSFSDLVGQALGEVIGSFVAYIVLERLWLA ARDWVSGHDAESEEAMARRRQRMLWRMFTRGGPDGAEQCSFRGTVVEESADESGGELLSS GAGAATRPSPLPGNA 315
6 Protein RL9A G9VYW5 MPWSCRCFSAVMTVNERPEAARPVAAAVAAAPLRDPDRPLWDPDLARVILSLMIIITGLA VALWIFTYVIFL 72
7 Protein RL8A G9VYW4 MPHSHLPQIVSFCAWPRQGLLLFLGLLVLFLNYHNQIAVAERRRTGRRIPFVDPLPPESE WYDDDSDDEDDDGDGDSVGIGVVFG 85
8 Membrane protein US19 Q8QRU0 MLHNLPLEWTLEELAPYLERFAVWLRVAVIVNFQLTVTVLLSALLWSLVPQLTELCERWD TALWQLLGLVVPVACLFALHGVQLAAYKDKLILMLGYCLPNTLAFMGPLMCQPLRALLYP ALLTWVLQLCCLATAIMGLGLSRHWNTLRRLLVPCLSLLCATALLMWLVTMPEQVSLLMH LGAVACLSVAVIHDLSLTIFRSSFPESFPTAIRLYVENVALFMSIYSLLTQSRPWRAASG WS 242
9 Membrane glycoprotein US10 Q8QRU9 MGDWRMIRCVLGAWLLSLGATDRQEGSSSPRATNEVSHFTCSCVIKNHVLSGTLQMHGLF TPGTQKAVALLHLGDDDRRPVAVKGLATATEATYTLGPTPVVWTEGGDERHGPLSEQNCS VSLEMSPNPRGELFMCPATAYDSGTVMGLVMDLVHMWYQGDYWAMLRVYVGIFCGSYVIT RSLLLLTGVDTGR 193
10 Membrane glycoprotein UL142 Q8QRX3 MLILCLVGYFIPFTKEYSLTYTYYLKYDVHGYSYIGYVYGFLNDSLFVRYNGSYTSNLRQ EAPHVITEGTQTWFETFVANRTYKDGEERKVSSFLRRDSINTKILYKYFNLSEPEQWNPY PRLTLQKYHACSIMNNGTHSDYYAIGVNGTDFLSMNSSTWWKTLNESASIAERKFDASTV DTTDIQNYLRTDCPWWLRHYSGKAQHTVLLPDDVIFRRINTSHTICRVSVFRPCEVSITG SNGTHHMNAASFFIGPNMNYTCSAWGTFAFPKQTAAQNYTCRVFHEGSNKMTEHRLEEKI IEGEDASSDMQVNEEAAVASIIYTVPVITTVAVAGGLYYGRRYLPTSHGYRSGEELS 357
11 Protein UL29 Q8QS59 MSSARRKTCVVAPHGMSVPNRVRRARRKRSLAPETFCARDLADLCVRRDYEGLRRYLLRF EGACVSLGWPSQCFYVVGGSHSPYLLTEIDLEHCQNDFFGEFRDMHLIGVVSYAACRYPV FVDAHGAVFAYDAQEDCLYELASDLGGFFAKGMIRCDPVHESICARLQPGVSLVHPDHKA ELCRRSRVSARGRYLRSLLCFRELLACGDDPQARSAYVESHRDAQLILTWPERHHLLVRN AQDLGLTASALRRFQRSLYTREPLTALGEIEGPEGKTFFNHVKILCGDTGAVYAALVGHD KLVKLARDLKAFVRVGLALLIDDFRYENIGPIDHTSLHEVNPELKLPFKKRRLIVGYFEP LSSLYLRGQPKFSSLWRGLRDAWIHKRQKLRERLGGVQLQRYVRATAGRWIPLCWPPLHG LLLGDSNYFGVVRDQKIYRRFSCLRQAGRLYFIGLISVYECVPDARVAPEIWVSSQGHAF AYLPGEDKVYVLGLSFSEFYENGLFAVYSFFERDYVDEVVESTWFKHTFAGMYELSQLLH DRAGLLRVCQLNAGCKIRLGGSPACTFTFGSWNVAEADEANGFVIGVLEKARYAVIGWLE PVQKAIFMDPLGGIHVLLYGTALVKLAESLRGFIRQGSFWFRCPRRFCFSPLGSPAATYA GGGGHGGSTGGAGAKPIGLQTLPVCDVSEYVFSDRRMLEGAGLSP 705
12 Membrane glycoprotein UL8 Q8QS78 MAADPHTTLSMLSGLCNKALWLSICLLIVAFLLASSSTTTMVYVSGPPGRPLSLHANFTQ DDDVHWYRLKGNETVSLCSCMVGDGVFIARSNMSLGCLPWQLILFNMTVNDGGLYYVNGT NGTTRTSTTVWFNVTIGLQFAPKTTKPPKKTTNKRAKLSERTGMSLFRYARDLDSVRRKD DDNNIHLGLGGIVMNVTGQPPSSPPFPGPSESTWNVTTGGEDGGERSVTTTTVAVSTRPT TLSGKTNASTSTATSTAPVTTTRTTTRVRTTRTNSTSGVTTRTTTTTVRPQPDCLLRTQL SYHHTVQAQPQKIAVHYTWLILLILFIVLVILFCLRIPQKLYDKWRNRRRYGQVYVVDTE L 361
13 Capsid scaffold protein Q8QS18 MSHPLTAAAAPGAAAIPPPPSSAVVPAPLTLPHDGVYLPKDAFFSLIGASRQPAVPATAP PSYPAVGAVPAYPHHPSPYSHQPPPPPPHPATGLSGGAYGGMHSVGYDDLAARHFGAYDP GVYWARRYDHLPPPPSYPAPYAAYGPPPPPPPQQQHHHHHRRRDMMDDAPSTWERYPYDG APPPPPSQQHGGGGHRQKQRSGKRRKEASQSSSSDEDLSFPGEAEHGRARKKLKNHGGAQ DGGGGEHHRGGGQHQRYDELRDAIHELKRDLFAARQGSALLSAAIPVPGVSHSAAPSPTT TTASSPAETPMITGDATPPPQTTPAGKVGAAERAAAAVAGVVNASCRVDHAVAGTSGGSS STTTAAGLPAAALALQNPPKDMVDLNRRLFVAALNKME 398
14 Tegument protein TRS1 Q8QRS5 MSQRFPRPPGRPHAHPNVHNPTTCKPHAGGQAGAIGGGPPGAPPSLNFWNSPERFLLAQI PVERRTLTELEYQAMGTIWRTAFMANTTSRAMRKWAQREAGGLLPLGRPYGFYARITPRS QMAGVGATDLRQLSPRDPWIVLVATIVHEAATGHEPLPSPGATAPPTGLDGLCQQDQLYL ALGVNFRVFIYDLQRNTLTLAARDADEWFRYGAGDVARLYRSNRLGLNAPRATAVPEPAL LRTLTKSDDVNELGRELRRRWQHTGIPLQTPGRLRQPWVILGSWQELENYEPFASAPHPP SLLTAVQRHIHQRLCCGWLFLGVVLPSRWLTIYCRHDTEAGTPQENPSVSADTGNDASSS ARLSSSEHGAATRSGGPANAATTSPQHGGRQTGTGPGASNTAAGAGTGTGLSSGMAPSQT AGRGNGPAGHPAGAPLITHTANTQGHGVAPHNSSAATCAVSPPLSSSAGPTSAAGTAAGA TSSGQRPTAADLLQQQQLQQLQQPPVRGTDGRPYAQALLVLDELGAVFGYCPQDGHLYPL ADELSHLLRAGLLGLLTLGRVSAPPAEAALRLLPDLDREHWERPRWDALHVHPRAPLWVR DGAGQLNFLLRPGRGESEVLALAAKNQGLSDSIAVEDHLNDARRRADAQALGLDLAMILL EAGGHLHKDKKGKKGRGKEDEPSAKGKSSKYNRPSEPPLSHQASIGRALRRDDEDWRPSR PIADDAWFDLDESIWVLGTSRKNDVVQRRWKKATIRCGLDIERPLPVPPKGCRPQSFIHE ATTSPPQTSLNYTAPEFSDPGNYVVPHMAPGFIQPVCMPAPVPYYDTTARLCRDMRRVTF SNVATHYHYNVQ 852
15 Protein US34A Q8QRS6 MKFFKSRARPPRLTVPRVLRFFGYAVLLAVAWQRLKKERAASLRRYEEKMRRQQVRRRQS FP 62
16 Protein US34 Q8QRS7 MNIEKLVNLLGLLCWIAAQTVSRIAPHARGLSPDQLHGLYRGLHLELLEPARPQAANRSV RDRGGPATCQEEKDRGGSFPRFSGFRARRVPSHGSQPRGSDTLPALRFQLPERVLLCLNR GCHGLYAVVERPRLVGVPVSNSTVLPVLWLKPGATWENGTAPIRGPEER 169
17 Protein US32 Q8QRS8 MVIATTDSERDWRRVMVESHALWCDCDEWQSHLYRVFDSDFHRRARNREERRAANWRRQM RRLHRLWCFCRDWKSHALFTIWDGMESDADSSASSSGEAPEQPVCKWKNARALSRAYHYR RSRGRRGTPPPRNMPGFEHVRPLWYNNPRDVREDERRTRAEPDRVVFQLGGVHPRRPFRI YEPPDPEEEEQGA 193
18 Protein US31 Q8QRS9 MSLLEREERWRRVIDYSHELWCDCGNWQTHVEIQDDGPNSQEPEPAHWLQYVECQWQLRV RDSHDRWCLCNGWRDHALRGRWGTAYSSGSSASSSGFVAESKFTWWKRLRHATRRWMFRR NRHRSPSRYSSSSSEDDDGSSLRTNEAYVRSQR 153
19 Membrane protein US30 Q8QRT0 MGNPASLLDPRMRRRDPELPLPSRLLAPVAPTASTRSLLAKNMELRFSLAWIWFPSLCLL LLRNPADACLVDVGSQVTIREQCRLQNGAMISGGVLEGNFSGGAVLELDYEGLDYLGEGQ RMQLHLSGLEKEDAAAASASSHRGHHHGRLRWSFYVQQRQPKYGIHRRVVRLRVLSSEEQ GRFDLPTSCAHQKRYHPLRDGEDNHDDDGSATHASHYNLLGALLVWIGSGLNIVWWTGMV LLAMDALGLGERWLRQALHHGETQQRSRAQALQHERDMFWQRRKRAKRSRAASEDGSVSP VIKISQEEKVRHLVALPWGGTQTALVTGEPLPSPPPLPDLPPVPSSAPPVLLSQRPPEYS ELPPV 365
20 Membrane protein US29 Q8QRT1 MGPRGWWWLCGVCCWWWVTFGCARTVTVDVVAPTVRAQSTVVYSEPPRSSSSSRGGTAKR RSTVSRWLRLRHGNASACVSEVDWTTQFFFSGCERYPSFVKLNGVKRWTSERQFLGEVAY YGGCCVVSGGRHAYVVLINGYGTATYGNALRLDFSRRNCTVPLQTYPRRLEIYDGQTTPS RCDPYRVYFYGLRCPQQLVLNASGGLELRRCPGTSPAAADPSRPRHRGDLEDELRGLCVD LLVCVFLLALLLLELIPMEAVRHPLVFWRRMALTPSSCRFERWCKARLRRLLGLPPPPPL APPSPPKKSPSVFATDNSAWAPLSAPPWRPPLPSVVPDSPPPPYSLRHATSLVTVPTLLL YTSSEASFAMPQTACALYATYGEPGEPAGSADASPGSGAAAAVSAPGPGGSDGLDAVPSG QEHGAAFQPGLDLVPEPVPSAPEEPC 446
21 Envelope protein US28 Q8QRT2 MTPAGALTTEFEYDTAAEACNLTDVLHQSRPVTLLFYGLIFIFGCVGNLLVIFTITWRRQ IRCSGDVYFVNLALADLMFVCTLPLWMQYLLNHDSLASVPCTVLTACFYVAMFASLCFIT EIALDRYYAIVYMKYRPVKQAVFASVFWWLFAFIIAIPHFMVVTKKQNQCMNDYEQLERS YPIILKTEIILGAFVIPLSVISYCHYQISKVVAGSQSRHKTHVMRVLLAVVCVFILFWMP YHLALFVDVLRLLHWIPDSCEFTKSLQKTLILTESVAFCHCCFNPLLYVFVGTKFRQELY LLLGNLRQRLFSRAVASYQTMTFSRRSSRTDDGTTQDTISETFSTVSELPY 351
22 Envelope glycoprotein US27 Q8QRT3 MSNNTTSRIPPKIYNTTLYQLYDYTRTWVWVIGFMGILLNLCVILTIVIKRRKKKSPSDV YLCNIALADLALVFILPTILEYVHNHKDTAHHVACYAMNACFYICLFANVCFWTNLFMDR YSAIVWGVQLNSIRNRRRSMWWSLMFWLFALIMASPHYALKQRSDSECVGDYSHDLTKVV FPVFINFKVNILGFLVPIIVMSLAYHNMVRFVINYVGRWNLQTLDVLLVIVVSFGCFWFP FNLALFLESIELMWSSTSRFLGGAIELCLHLGHFFVYFRACFNPLIYIIVGKQMSKDMCD TFRSMCLCCYPRTVPYQDIDLEVKKDFQRRLKDSKKASYHGKNDKVPVEDTEFLL 355
23 Protein US26 Q8QRT4 MRQSYRYASGAVVRRTLRGLRKIFTCQDSRQEVRQLVRSYADMNISLPIPAPNGWRLDFV EFQDIFGESAVIDGPDSPWGRLICCEESLEPLGVLQYSSSVLPVLRRPRTSSDEEDSEDE DFFLYVEEIESPSRARLVLLLGRYETMWCLDREQQTLYYLAHSLDDFARHGLLHLEVIYA DKMRTPLLTTQPDNMICDLRLHDHNINELQRVACRYRGECIPLRTPGEMTRPLMLCGHAD NLKGVWPFICMETPQFHNLLKFFVDCLCCEAMVLGVVGESLPSGLFHAEFVLLADRGCVI FYFDVFRREMWRLANDIDMLFTVGLMKIYQAGRRFHFAVEDAERLEMPGRCPHENFPFWD RFGAVERVRSFQRHHEQRYKWLVRRDRFYSRTDGCYARNSLDEVSGASDVSWDPRVRPDY PQISDLECAKQYWQQLNDHVREQTQRYGPSRRYTMWYGMTSRLERAVKRLQQRIPRRDLM NPSLVSQGLCVYYSDEDEKPEAENGGDSSDEEENQKQRTKSEGGSGTEAEKTTGKNKKVE EDISPAYRRVLTRRAARAAVLEGRPAPKPAMPHPSSYLPFWI 582
24 Tegument protein US24 Q8QRT5 MDFAGGPGAEGAAEAALAAVVPPQLPSLDALMGLPGAAAGEDPMALYRQVLRDFKDLFMC LDPLEITRFVQRNEGRCLCLGPPKGWHVTLRLEDEIIVSAKKAASKLVCCGEPLTPLGYA VILLPDPRRDRDDSVISTPYVVFQGRYSRIYAYDTRDQYLVLVAHNLDELARYGVSRSEI AYRDVVHTALRRRQPPLPRRYPRGARTMHILFLNDTTPEGSYATAERILNCDVKLHTPGY GTVIMRLMKTVQQLQCVWPFCALNDAECRRWWWGIRANLCTPWYLLGVTGRPRPGRAFVA EVLVLLDWFGAVYAIQMDDPNHYVRRVANSVTEFFRMGLLKMVFRHRRFERERQRQTRME HRHLCPHHHERAVDHKRDILFNEDAWHPDERRERERRVLQQHYEWLCLTERFDPHEGAWE RLDPNALVLHRYDTNSQTYVVDPDIVGLQAAEREAAERQDDTGPRLHCLVTTRSSTRDGA ERVISALVQQSRLVTYSDPFPLKSLTGVREYIQI 514
25 Protein US23 Q8QRT6 MWRTRWEEGAPTFTRHDEFLYCHTRYETFLRVMGDFKAIFERQHSAEVVRDWVRNHVDQV LSLGIPHNWFLQVRPGSSMPELRDQLLDDVICCAERLIVLGKCVVLVGDRYEETELVLCM GGSTRLYIYEPSQEILLLCAKHLDELARYGLLYTESIYRQPQTPYATRVPHDVVRALLHN CRSPDALAACVGEHHGRDVNFHTPGRHAKTLKLLTNFGCLSECWPFEVAAPCRLAECEMY LSLRLRCRWFLLGAVGAYRPGGFFDVSSLLIFDRFCRFYTVIVKTHLDRSPTTQRLAGEV YRLADDLHELFRAGLMKVYVRRRYEHGLRRSARLERNGPCVHLGEGARLHFTMFDSGVDR DYGRQYRWLCRGDRFRAEMLNTWDGWDAFTMWQTRVMRGEFGDRRRARPPEDEEGDEESQ GRRRPPRPPGPPLPQEEDNHVVPDNDRYIEVYGHLEEVEDEEADDEDEEEPMEPDNVVPE GQPQQQPQGQQAPAVAAAQARRLAAHGGNGADSEDDEWEDLGFDLEEDTVFDLKDVDEWF QQRREAEAQRWQLGRRIVDAYQTEAEVSEAEVEARRIHLNTDLSPEWVKSFDFREHFV 598
26 Tegument protein US22 Q8QRT7 MSLLTKAAAEAWGTYLRQRDERCEDAIRCDYGVFQFRNTIYQRTLSLLQGLYLRQYDPDA LRSYVRQHRGTTVALRNPANWLLVLRETAAIPQIYARSLASEYLCCDDDLEAVGVLAVRP ADDDPHRHTKWAQEVPCVLMMGKHGTVYVYDWETDGLYEVASDLKVFAKNGLLWCEYVYR HPQTPFSTTEPRYHVQKFLCADPTDAVAVAQTAREMSGLNLVIRTPGRTEVEPLLMLGSV EALRACRPFDHMSAAEFRELRVFIRQRLCCEWYVVGMMGYYLAYGPFVPSGVVLLDQFGV VYFLKIEDSDLYRLADNFHMFLKCGLLKTRGLCRFDRGLRGECRLEELPVCHHTLKKNML RWHGALGTITRAQLESALDWFLRPSRGQDKVPNNNVAWGRTDLLATGALQDHHQSSFFPA QRLETLPALQGGLWEDNDETTQAVEGQRCFRVAKCFPPTPHMPYNECGVELSCQLSSDED EAPRQPRRVAPRAGNPPHTPYPSDNEEGVEDAPRDEGDTPAPPTEPMPAEEDDETEIPSS QLGREEEGDGEGDDAGGGPPVYQSECLPTTEREAWLHRGRRAKAMHDCGHTLKQVVIPEP DQMSNEMDD 609
27 Membrane protein US21 Q8QRT8 MSLRGQVQVARSVFLLRIYILMWVQSLILMSVCGFCWLVFPHKLEHLFPSVRLTLSCLMI SIVCLGLLRWAEPNFPKNVWLLLTYTLLTSVAVTASGFHFSHRSVIYAMIATVVLFCFLT LATYTFARDVELQRSLLTAASALILLLFLVFSLFPEEVGEIVVMVAGLAVIVTSVVCDTQ DILHDIEYESYIQGALYLYMDLMYLFVSVLYFMPVNRPTTGATQNFVS 228
28 Membrane protein US20 Q8QRT9 MQHQEATTLLLSRVEALEWFKRFTVWLRVYAVLVFQLAFTFGLGSVFWLGFPQNRNFCVE NYSFFLTVLVPIVCMFVAYTLGNEHPSNVTVMFIYLLANSLTAAIFQMCSESRALVGAYV MTVALFITFTGLAFLGGRDPYRWRCISCVYALLVLSFLALALSGHENWMQKLIMTLSAFS ISFFLGILAYDTLSVIFYCQPHRCIRYAICLYLDVMALFLMLILMLSGPHWIRVSEGLEA GNATARSTAVAKAT 254
29 Membrane protein US18 Q8QRU1 MGDRPDAASRPPPPPSPPPSPPPSYRETVERDEAPPAVAAYRRALAAEPYLFHWLTRFRM LVGVYHGLAWQLSCTFTVCLLAWFAFPDVRGHCAHGVVPAMSSVVPPLSLAMLRGVAEYR PRFTRHAWLTVACLVMNTGTTVATGFCGERSVIGLAFALTVLFFVLCTGLSYLGGLNNTR WKLIGTCYAWVVVTYYLLLYFSPVIWVSKIYSGLYALIVTGAAASLCFETVDLIYLRTPP PPKNGVFISVIMYAIAMCMLNMSVAIFSGHLWLQQYAKDHHGQITWLDVLRLH 293
30 Membrane protein US17 Q8QRU2 MPPDHAEEMAAETPLLVRGGPGVLMISAMTASDVHRFLVCTRVYSTVAMQATCTFLLCLG MVLAFPHLESTVFLCCTGFMPPLSLAVPTVCLAVLHSKYEDRPPSATVLTIYSVVTTLSV VVASACSSSVMVVGAGVLACILFAICTAVACLGGMDRRRWQVIVSLYLLSVAVLLMGIYV QPMSLGGRLFLGYYVTALGFMLAVTAFDTSRLFDVSWREADLLALCLYENFAYLYLLLLI LFTTQDSHDKLVAWMAWMSRSTGLEQSSAAGCDLLRAIRRNLTRLLA 287
31 Membrane protein US16 Q8QRU3 MRSLRFPGVGAPAYRRLLLSPSSESDEEQERYEASLAAALCWLERFEVLSRVVGLLLFQI AFAVSALGGFALVFPAKVLRAYPGFPCGVPWTPEAALLLCLASACWIYWRYERPLSRHHP RQRRPLHELALLLGGLLVHLPLVGLVCVCQEDPAPVLSAFVLALVVTFLCAQVAFLCRGL RAALNQFMLINTVWFAVFLVDLLIVFTRDWPWALRLLVGFYTTMGIIFAGHLSQQVLMVR YLTMPRDAGWTSVQMFSSVVFIFFILLRVRTCTDLIQSLLSLPSFSSGSSLPVMVTFAPF SGNASSGSLLPLSISL 316
32 Membrane protein US15 Q8QRU4 MRSPVLTDKTAVYLPPRLRARLTARSLAWVYQFRVTVYTYGAVVFQVAGTLSLLLAFAFV APSAWRQHPRLCFTEGSPSLTFLVPFLAVLCLYCAEKSHPPKVSVLLFYTLINLPPLAVA CLCISPFQLLAASLFTLTGFATFTGLALLARDHDIRRQIVLVHVLVTLAFVAALIVISLR EGSWYLKVISGISVLIACLALSHFHETALAVRYETPLARTPLAAAKVFLNLVFSLLMVLR ILTLRTFLQTYFPVSES 257
33 Membrane protein US14 Q8QRU5 MEPPSPRPAPDGGEEDGGEREGGEEEEETAALTEAQTDDAVFWLQRNVVVFRVYGLLLLE TAITVLFSTLVWLGYPQLSYRCQEDPSPLLLSCTPVLVLGILEGTDYKHPSNALVLGLYV AFLSFSAAVINFCSTVTHAVSSAILTWALFVACNGVAWEHRLRALWRDALFTTTLLTVVM GILASSYQLMHKMLLCLYTVFVGCILAVLFQDVRHVATELPVDQAIRGSLLLYSTEMLIY HTTLLVLTPVMWSARWDLMFSYLSGHRSNATLSAVVSPSVSATPGR 286
34 Membrane protein US13 Q8QRU6 MDALQRDWAELLRLHRTVMWLRRFGVHMRVYALAIFYVAATTAFCGAVWLGIPEAHNLCQ KESSPMLLVFVPTLLWCFILLRGDRHPNSLVIAGCYVALLSVSTLIYTWCSELPAILTDY VLVITLWMACTGAVMTCDAFKARRWETICSRVLTSVFFITLWVIGDQTVFRHQRVILYGY GAILFIMMSVTFYGTRYIRDELPASDVVRGSLLIYVGLITMFKITLIVLSPNLWHLPWTN VFSSLRPHHATPSASSRVSSSI 262
35 Membrane protein US12 Q8QRU7 MVQIQFHQGEPLGKDKSSEPRKKEEREEGEKTAPSSSPPTPPSPASTTTTIPLPPRIFNP SDEQTWKGIQHFLWIVRLYGIVTFMSSATLVATILCMLVPWRIEKVYLRDTLPVWGMLIP CMLRQYGQWMQNNRKPGSLLMIMVYTALTTLPLAVVGLCFDKSLIIQAYVVSSAMCVWAT GLAWLMAWHVSRRLAIMGLLSLAVPLLWLFVAIQPWAVHQRVVMGVTVGLVYALQVLMIR DTLMILYLPPATDYADGGLLRTATILYMDQVIMFLLTLVPLTSHLWFPTYAESLNRTAQR LLFRQP 306
36 Membrane glycoprotein US11 Q8QRU8 MRLGLLWITLCSAVRGEDVCPRSWSLPYANETVPRTAKKTTTDTVPGFPPWPDISGYAVE HSGVQCVIRHGGKLEALWILRGNFSAKGPVPKAYYRYDGGVSEDIPLQDVSGDTAASVRR YWLYGYPVRVDLRRVFFYFQPCYRCHAHWTECEPAAAVPWLPLWSSFHDVRRLLHESRRL TAYYVMFVKSFQYTLMCVMAIQVFWGTCVQTWPYHDRPWLIWDHM 225
37 Membrane glycoprotein US9 Q8QRV0 MQLKESQSLIWHCCVIAVSVLSGRSRETSFRVSGDESASDRTCPTSSPYSSQSVRLPPYP HPVGDNVSRYRVQSSVSECYVQHGTLVAVWAVRGNFSEPFPRVYGTWGNERSASHFQVDE PRIETDGTRRYEVELPQVDARISYVMLNVYPCSTCNRSSLHCQPVLRLPWLPLRTTSSDL ERLFVEQRYVLLAYVVLVQFLKHVALFTFGIQLACCVYLRYVRPRTRRHRRRHPAGRITA AAATVTVTPHEETEKNR 257
38 Membrane glycoprotein US8 Q8QRV1 MGVPCLVWCFAVLLCVWGALCAAEDDYGEDDYEGFSSQRHAFLYRNKVDTYEADCVVRDG VLEAEWRVRGSFFPEDGLLGRVSWQGHRGRRWGHLEAPRREVSRDSATFRLTQRVPPELD YLILNIIPCMRCKPLWCEPRYHIRYLNYGTSMDNLQRLHYEYRHWELGFVLGLQLLAVLM LGYVFAKMVYELSRYHYMRYHACVPQKCHPVKPLY 215
39 Membrane glycoprotein US7 Q8QRV2 MWTQLHVFLLCLTAVTGYGRRKLSRREIALDFMNSEAWESDLIAGRLEFKKFMRPYPKNN MILSHTVSCTIYGGNMTGIWHLEGQFYPSILSEIILTDSDGSYEFIPHKATVTEQSLSVE IKHPVSLTVSHVSLRVFPVKFSQEYYSCTPTVELPWIPQFSFYEYDSYRLSHEGRFISLC FYVMIWAYLITLALCATPLFWVKVFEMLRRGIKARYAGSVRRNSLFYAAKCQ 232
40 Membrane glycoprotein US6 Q8QRV3 MRYLGLLKLLGLALFSVSAGRADPRDAPPEDLLSLFHRRQTCVPKKRIGVSECRNGTEDC DRTGGEEPEDDAAERLTSRWIQTALESYGNKAREGEEEEYRHPEGLINCRQVSRLLPCNA SGLRPSHRLLLLMSNCVCEGPAWGVIRFVERHGLIAVSIYLFCMVNAVIFTMVLLCGVRG EQLERSSRRCGS 192
41 Membrane glycoprotein US3 Q8QRV4 MKLVIVLAALAALLLGFSEAFPRPVLSIAQQLTGLPTHFLVEENECRLHMGKVYFRGKIS GNFTKRHFVQFGIQSRSYRDNLEVTESQWSQKAETYFEWNVEGIAVPFDVDTVDVLLSSG WGEPKKWASCDPQVQMDYSSWTVGWYFQRAMRDDNWGLFMRTVCVYVLSMFMLAYLTVGM SLHMRFF 187
42 Membrane glycoprotein US2 Q8QRV5 MNGMWMSLVKLWASMGPLIRLPALDGPPDPHTEITSYKPWKSTATRPWFTIDENRCHIEN GQMFGRGSVSGNLTTFVFDPKADYGGVGENLAVRAEDVEFIAGENLIWRVQYANVLPLIQ RLVVRLVLNGDVVWLTCVPEIRVDYTSNAYMWNMQYGMVHRSYRHVALAVLFYALSVTAL VIFIVYVTVNLEMSLKWMRFFMC 203
43 Protein US1 Q8QRV6 MASDCGHPPVVGMPVMSSAVSSLPMRELAWRRVADDSHDLWCACMDWKAHVEYVGVSAEL RPGSGAWPEQVEAQWRHQVHVAHDVWCDCGDWQGHALRSRSRTADSGMSSSSMSSYASAV SCPDLSEGVRQPWWKRLRVRRLKLPSWARRWSSQRSGCSAATSATRASRRSQDRQESSSA ADSYS 185
44 Tegument protein IRS1 Q8QRV7 MSQRFPRPPGRPHAHPNVHNPTTCKPHAGGQAGAIGGGPPGAPPSLNFWNSPERFLLAQI PVERRTLTELEYQAMGTIWRTAFMANTTSRAMRKWAQREAGGLLPLGRPYGFYARITPRS QMAGVGATDLRQLSPRDPWIVLVATIVHEAATGHEPLPSPGATAPPTGLDGLCQQDQLYL ALGVNFRVFIYDLQRNTLTLAARDADEWFRYGAGDVARLYRSNRLGLNAPRATAVPEPAL LRTLTKSDDVNELGRELRRRWQHTGIPLQTPGRLRQPWVILGSWQELENYEPFASAPHPP SLLTAVQRHIHQRLCCGWLFLGVVLPSRWLTIYCRHDTEAGTPQENPSVSADTGNDASSS ARLSSSEHGAATRSGGPANAATTSPQHGGRQTGTGPGASNTAAGAGTGTGLSSGMAPSQT AGRGNGPAGHPAGAPLITHTANTQGHGVAPHNSSAATCAVSPPLSSSAGPTSAAGTAAGA TSSGQRPTAADLLQQQQLQQLQQPPVRGTDGRPYAQALLVLDELGAVFGYCPQDGHLYPL ADELSHLLRAGLLGLLTLGRVSAPPAEAALRLLPDLDREHWERPRWDALHLHPKASPWTQ DPEKVFNFLTRQGRGDPVWNRWDFLMRDSEAVEIFIDELVVQRQAQLPEKYIGFYQIRKL PQELKRPKKNKHAHPLPMYDELTEPLSPQASLCNALRTDDESWCPQSTVHDELAWMDLDE SRWEPGTSRTDDIKQRRLAKGTLRAGAEIDRPMPVVPAECHHQMFTAGGHQVIPLCGSEP EDDDEEHIYEEIPPRPPLPTPRTSLMSAGPKTPGGRPRPHTPPQKPPRSPQVPATPPRPS HKARAPPPPRTPQSPTSPGGYVRPPRPPPPRGDVQTEAQLCHKMGAMNLDHQYPQTPLRS PPPRPPNRGPPAPPPRNKKKQQQHPSHTHVPRHVRQ 936
45 Chemokine vCXCL4 Q8QRV8 MNALQGGERTGPGGTRRRGAILSQSQHHYNTPPHIKALTNTLRTPPQHLQRHTTDLHATT TTTTTSTNATPRLLAYATLLLLCLLQLRLKTSFATRTATTSECLCPHKNSTRRTQPSNTW LCIIPPHTTCNVKEALLYNDTGIGICLNASTKLAKIHRRACFKLKHRNDNTILLGPREDI PYYWQPGPRFHPKALIQRTILDWFRQIPEEYGHYIYHGLDGVWELGWP 228
46 Protein UL156 Q8QRV9 MGIGLAIIFTGNVRFPNRTAIKTLMEMETLVYSCLCVHPTYATSPFNTPFSRNIPKPYNT PLLFRTRCNIHRLRQGDTVCSSTPSHYFSTLSSYLHTQSPTSTNVFVTHVTKYTKKPLQT VHGCVNSTTKTVVPHPLFFYTTRRRTLSPQKSHTCYK 157
47 Protein UL150 Q8QRW1 MARRPPELAGMLWWWWALTAFFPTSNEISPLWQETGTCRNTFAAYYYCHALPGSGEGRVA APAPELRSSPPLSSADSSTTVPRNEHCSAPSGPPRVNIRQSMRWRRLAMASSLSASWPDT QSRAASQSLSKTMYATKEPMTSPRAWPTRSEKETAEPRDAATEAAADWGDGGKTEGARKE TGKEEVPRWDRHRLQPCQAQRGTSSRATSQMASLKAVHQRFLGLSRSSCSTTLQPVVVSP PFSLTRGGALTTASLATPAGGETIKTEVMGRRGGEEGEDDVVTNDDPPSAPASPAVPLLE VDVQRRWVKPSSASPATSMTATVPFTAPAVAPAGAADGAGAAATTVAAGEVGRRCSSSDA VVEQQLAPSVLRESAEKVRFNVFRLRTPLLASRSGVGEVMLWVGFLPRELGGLLWPLRDE RHEPEEAERAECQRRFARQPADPGDSDCLCRCPPIVTAARRCEYNATHYLHALEIELQPP SSGGAGESEHGGRNETHRGYPEPQKPRQAPSQPENETSRVGDSQKTTHERRQEPHENGSA SSGRNGPADLYRAPHFVLLDAETDRGRRPVLALGRQTLSGWPEGDTPQLLGLVTGKDNRC QSLWPTQDGYVRVPASSVSPKKADAGDGQSRERGDSADARGGEGGKRSRAKGKEERGREP RRSCQATRVLREVAHTLETVEAFYDTLRALLRTYWDRTRKWWCDSLASELQQRDQLAGRL RNLEL 725
48 Protein UL148D Q8QRW2 MTAPTAGTGYLVKTQERKEWWPDNSLKRWWIGILVIIIIGVSLVAFMMFMQKHGASGSTS SG 62
49 Protein UL148B Q8QRW4 MMETLTILAICVGVVMGCTVLVSCALISFYYYDEITDGQRPKLFRRGARRGRQFDRSESM TAILCEEGASSDEGECYTTRL 81
50 Protein UL148A Q8QRW5 MSDDYSDIMEHWIPISIVVVLTSLIITIVVNAYLWYFRRDLAAFCRESVCGCCLRGETEP LTRAMEPPAEVEMRTLSSSVEELTTLDVGTLGVLELQV 98
51 Protein UL135 Q8QRW7 MLEGSLFLVGFAVLMALTAFALLIVNRRRARKHKSRRRFSSTDAPPGFCGCCQRSDKGKP VPVEIELMDGPRTPQKKKKPPLSRDERDDLCTSVYIGEPKTPKPEFPPSRYEIPDVVVTV PSTPSSLRSAGEGREGEDGREDDDTSSTSSDSSSTSVDTVISRPPSWKPAPPPCPSPSSP SSLGEALEQHRQLLKSRPPTPPVRAPSTHLTVPTVPPTPLPRTVPTNGVETPLVKVTANG HPPAAPGRKKQGPPTKPKPVWPRPALTPQTYVDPRTPTEPTRPGEVETPATLQHKPTPHK PPRTPRLPRTPAVQNLTTMNGCSTLTRGRKASLSSSSCSSTLPRAPGTMCQPVSVKDVAP PPSWTDIDNILDEALRNVLRDAESMQT 387
52 Protein UL136 Q8QRW8 MTWALDVGKHKCQRVERPGRIRRLWECRLRVWWPGEEADEKRKGEGERQEEDKGHYPMSL VLHAVCALLLTLMVLAVGALIAYLRYYHENDWRDMLHNLFCGCRFPDECRGRRHRRWGRG GHGDEDEGDEEQDLERGRASAALSPSACQMDTIELVDETQPAAATTVAAGTELSVGQQTL PPEWLGAVQCAVQTAVQVAVQVSAHHPSSPLPSPAT 216
53 Protein UL138 Q8QRW9 MGDIPTSVWLPVVCLLVLLISGLLVYILYHWRDTLTLLRLVWSYRWLVNCCQMYGEYERR FTDMPLGFGPVRRESDAKYRFPGRNDEIYVNWEPLNCGYYSPSTRSADSRFSSWAVSTSE ETEMLPGACHSVSAAVEMVPMGRGVRGSIAGGDVDMFYDGDLLQPVMGSTTQFITVATVH QT 182
54 Chemokine vCXCL3 Q8QRX7 MKFLLSIIIVHITISTCDAVTREQHCQCLDRRWPYPIPNSWIYVYPPGVECGRTEAIAYL SERSRPVCIEYPNKFYKRFRLSTWHHFTYRNGNRVCIFHKHSPDWRPYKKEHIVAIL 117
55 Chemokine vCXCL1 Q8QRX6 MRATWGFMIGLLATWICVNIATEMRCYCSGKNMSPEHWFPRKRHQWVECISSSYRCPNME LIVHLPPNYNQKVCLGRHHEISKQFLTECEQGYRWFSVIVNATQKTPLILSKHTDKPTNF NQPNGYQLPVRT 132
56 Membrane glycoprotein UL139 Q8QRX0 MTELRLASSLLLAWEILDMSLANSYTQGPKIHANVTKCIWKVKNETLVIGKYIDIKCEFT EVTDNITMGLMYTSCSNRSLSETTMSYYNHTPQDRANYPFGKVEHSRSDTTATMTLRRCG LNCTGIHDCFKFDGQKMNITLRTSIAPIGTIYVNTKANQSHDVFCAVNDTFPATVLLHNT GNDHQLNITTNHTVKKCNRTLYYGYTVQGISPPTQCSLFSSTCIGLRSHTLTYPGTPLTP PAGISNCENYTAPNMTVTVTLVALSSAVSAALASETTTGTSSNSSQSTSSTATTGTGCSN ANDTNNNGLNQQQIIAGLLGGCGFLSLFFIFTCILCVWYCFRKLFPDCCGGDPDEQQRQM TRGRYTYDNPVFPPPTLPMGATGPAYPPPVSDGTAGPPAIPLTQDKVTYPRS 412
57 Protein UL140 Q8QRX1 MTTASSTSSTTLSTATTASQSSSSNALTALVVFGFIASMLLLFFILYVWNNDAFRRFIIK CGWLNRCCDRFDEWQDRVILRRPSRHASESGSSGTGSVGGASRSTSVSSVGSHRHARGSG DERLYRGIDNPLHRLMSDACEETAVEIDSIDDWSSVFQPCSPSYAERDQDSRELLIDLPP PPVPPEVVTAMQQAVRKAVRNALRNSHDFVQPYQTL 216
58 Membrane glycoprotein UL141 Q8QRX2 MARRQVGKVRRLLPLLTVVGMLLLEPEKSSRAGALLSDAAAPTGLPKETRAENYEIVSPA PMLVAEGERVTVPCTVMIHQWPLAVIRATFCLSPPTERSVELVFNLSRGGEVVVPLEEKL TESRLRGGVSYNFTDLHVAHLFSLTFRATASSAGVYECLLRNDSHALVLQRFVVLTHLET LSWADEPCCTPPLGRHSQDRQIWSPTPWRLKHVDCGWSSQMGFRRNRFYIEPASIGDGTE INIDAGEGEDEECWGPLCQPEEQPDRCWPVVRQYRLPGGCYRSGDKQAKFVPALPPTEPP LATPPEIPTGLSPWATRGVASFLGFWGFFSVGFVCYLIYLHCCRRCLGRRGDGYRRLPQY DEYPGHRRMKT 371
59 Membrane glycoprotein UL144 Q8QRX4 MRPLWTLLCLGSAVAAARVAGIRCKEDEVRMGGECCPKCSDGYQMKKPCTPLTGTVCESC PNGTFSVSGKNCTNCTKCTGHKPVTAQVCTRTHDTVCAPHYTVTPREDKEEKGETGRQHH HRHRNESVVYVGKEEGNKSNRTTLAWLSVLIFLVGIVLLILYLVTAYRSDRCQNYCPLSA LIYRSL 186
60 Protein UL145 Q8QRX5 MHDQHAVSAAHYYSFISGPSAMVHYRHQNAVQLLCARARDGTSGWERLTHHAAYQADYGA YAVLMATSQTKSLVLHRYSAVTAVALQLMPSNVLARLDQSDWVKGAWIVSETFPTCDPDG FRDRRSSSSGDEGENDEGDKRHEGREGESAVGGGDA 156
61 Chemokine vCXCL2 Q8QRX8 MVFQNLSRQLYTRVRFPLCTIFIFLCCICPTHSLEFEDDRQCLCANHILLNTIPAGTQYL KPITASETCARRQVLAVLKDKSTKCLNPHAPAVRHEFNRLFFRVVFDAEQEVYTVIDTGI QFLGWPVPHAYKTYLWKRVITLNRIKYGLRMF 152
62 Membrane protein UL147A Q8QRX9 MSLFYRIVALGALGALTWYTTNVIGELAEGSCVANQPLEEGDDEGYGDDPALTHEDRDYR ALWAFSLVICGTLLVTCVL 79
63 Membrane protein UL148 Q8QRY0 MPRFWLMCFLLTSLSEHVFRAHGSQLLNYVQVRLLSGRGGPLVFAHTFSSVPWSFTELGW AVCADWDSMKCTPFWTSNLTSSWSPPSDTVWRYRLSDPGATITLQLQNQTAPWPAGGLSF SSRLQLDAVIENAGLYVAYVVNDGDRPSQFLEPRVDFVRFALYLETETQILENLDSGRLV AQFDTPDLAFGPDLVSSFVISGNGERDYHLNWTVRRSETYRYDNIQLQVEIQEPRGLRHR ATIERPQYKVGSHLSLDFSVYRHNARLTRGYVQYTFPKEAFERAKRLREDPKAAGWLATI DRFVVQYLNALLITVMGILWVRVLVTWWMSSPR 333
64 Protein UL133 Q8QRW6 MGRCETICTPACECIWGNIITFSVLTVAGSLAIWSIAASNGTTPGIVSLVLTGLLFIYLI IYVIRFPQLAREVYVDFFTCKWVFWCSSKCTSGSLYDVVRFQRGQHTDQEGENRDRVICE VVAKPPEDPGEGPSDPSSQPLCEVKVEIPNPNTKPETKPEKPEKPKKPKAGGRSKSKSTE KPASKSTSEKEKTSGDMGTKATTPTVPTTPAPTPTPVPAPAPQPTVSGVPQALPPDLAAI VQAAVTAALAAAAQQQQQTPPP 262
65 Envelope glycoprotein UL132 Q8QRY1 MRRHPTGSLGNGTNTTLTVCLAFFTLYLTLNHGTTSIAAASTTSSTPAPSTTNTSSTVTT ATSRNHNDSITTAYDNSTQKKVEWIMTIVVYCVIGSSILSFLVVAFCVLYVSCRKPGRLY GFTDDEVALLLDLDDDDGSQTLLGKNGGGSRRGRIPAASSSHFYQPLDNDFDEDATTAAR ESMNKDPQNVIYFKKDGTLDTSFVNPNYGKGSPMTIESHSDDDDHIRYYMTVYDELTASE MEEPTHANWQIPKLIKATTTPVTLKEPEYD 270
66 Envelope protein UL131A Q8QRY2 MWLYRVFLSVLCLSVAVWGQCRREEAERDDFARPWDYWDTCSPALPERTRQEYVKRLVDT LVEYHYDVSHGLDNFKTLKRINVTEVTLLAGEFRRQKARGGTNKRTTFSASGFLGPHYRM LEFSVRLFPQ 130
67 Envelope glycoprotein UL130 Q8QRY3 MHLRCCRRYCHRRRARDPLTLLLSCAFFLSFLPLTSAECDEDRSPPKSTAASSWSQLTLQ EASSPSSWSAFTAYLKTQQAASLYCPLTFPSPPRRLSEFTRYHEVPGGPSCNNETLVLLY NRDGQTLIERPSPWVKKVTWYLSGRDHPVFQRFAKTASTANDGNVQIRTDDAKVFGSHMV PKQTKLLRFVINDGTRYEMCIMKLETWAHVFRDYSVAFQTRLTFTQANNQTYSYCTHPNL LV 242
68 Membrane protein UL124 Q8QRY5 MKTVWLSLVYLCLPLLAAVTTERQLPSTAVNYHNTTGVTSSLTFSSQLSGTSSSVSSSLA LSLQTAESPWTHVGSPGSLLEAYPTASALGGMVIVVGIVICLSLASTISSREVPSDDEEQ EELLGTWPEEPEEDRLTTLPWPGVPEIAVEIPC 153
69 Regulatory protein IE1 Q8QRY6 MESSSGKRKMDSANPDEGPSSKIPRPETPVSKACAFLTSMIQKEVNSQLNLGDPLFPDVS EDDLKSFEDVTKECDENPGKDILQELVKQIKVRVDIVRQKVKTHMLTKYTQMDEKFTAAF NNMGGCLQTALDILDKVNEPFEDMKCIGVTMQNMYENYVVTEESRDLWLQCLKDLHDVAK NAASKLGNALKAKAQAKKEELNRKMTYIALKHVEFFTKNSAFPKTTNGTSAAIAALQSFH QCSPEEVKCHAQRIMKTLDEERDKVLLHIDNIFMDILTTCVETMGNEYKVTSDASMMTMY GAISLLTEFCRVLSCYILEESSVMIARQPQITKEDLVSTMTRRIQEICMRVFAQYLLGCD PLRVCSPSVEDLRAIAEESDEDEAIAAHVRATAVSSPISPPDSPVPSESDIPLGTVTVAE TSDEEADEGEESQAEVEEETQEEEGEADDSVSVKSEPESEGEVHHAELVEVKDEDTDSGE EVEEEQQPASGKRTHPMVTRSKADQ 505
70 Regulatory protein IE2 Q8QRY7 MESSSGKRKMDSANPDEGPSSKIPRPETPVSKACAFLTSMIQKEVNSQLNLGDPLFPDVS EDDLKSFEDVTKECDENPGKDILQELGIDILAQAVNQAGIDATTAGVTPTTNTCTTSSAP STGGVCGAAPPSTPSPPVLLPERSVTPDLVSPRKKPRKTQRPFKVIIKPPVPPTPIMMPM IKREIKPDPDFTIQYRDTTIEPTSCIVISDSEEEEGEEVPQKQSESQPRQVQSSAASSSS SSSGSSSSSSRGCSPQVSPATQKAARMNPLLHRQQVQMEVHPPSSSQKDEDSSSSSSSSC SSASDSESESEETKSAPSCVSLTATGGVVRGAPGGSQNAGPRKKKSKRISELDNERVRNI MKDRNTPFSTPSAQTKRGRVRTEDVDRMFRNTTRSLEYKNLPFNIPSIHQVLEEAIKSCN SMQVNNKGIQLIYTRNHEVKSEVDAVRCRLGSMYNLSLSTPFLMEHTVPVTHPPDVCHRT AEACASGVKAVWDMKETHTHQLCPRSSDYRNMIIHGATPVDFLGALNMCLPLMQKFPKQV MLRIFSTNQSSFMLPIYESAAKAYAVGQFEEPAETTEDLDTLSMAIEAAIEDLRNKSQ 598
71 Membrane protein UL121 Q8QRY8 MMVAWWYLVCTVLLWMTVGGSGAVYICSPNTGMVKISCYLPKLDRRLWWSLRDGETRVPV FSPEDEEEGGEQKSGHEERGLHSVSVRHCKSCVRPHVVSLVTPLLLNRTVSLLLVDREQN EEKLLCFTRLTTLEGIRTCRIDPDLGLLYAMCLILSLSIVTAALWKLDCDRRARGYKS 178
72 Membrane protein UL120 Q8QRY9 MQRVRVTVVLVSVAAALRYAVTAGGEAAVAQVHDRTGEPGVNISYLYKNDTNLTILCNTT ALQSPFLASGIMVSTKRNTTIVAGKVNYTADNEKKDYHHYLNVTLRAEYGTYLNAGVTCW GSNGTWGAKTFEVHSMANQTDNATEISFHRVTEQELIDNPEYFRRSNKKLVMIVIVSQLV FVMLIINASFVWSWKFRRHR 200
73 Membrane protein UL124 Q8QRY5 MKTVWLSLVYLCLPLLAAVTTERQLPSTAVNYHNTTGVTSSLTFSSQLSGTSSSVSSSLA LSLQTAESPWTHVGSPGSLLEAYPTASALGGMVIVVGIVICLSLASTISSREVPSDDEEQ EELLGTWPEEPEEDRLTTLPWPGVPEIAVEIPC 153
74 Membrane glycoprotein UL119 Q8QRZ0 MSPLVTIFAIAALVGDMTGARGDKNTTASSTSVPVTTSVTTNSTVTTSVIPSTTAAATSS NNGSVNATSTPTGKPTSEATTAAISTSKATTVITTAKSTTPRATTSTGTTAPKSTTEYIF DKYSVSCESAYSYDYKLFNTTCKIKLENATGNANLMAITCYQRPNCQGNFTEFGSLNAKE VKTSGGYQMDFNNTGQALSVVGPVPRTTVEYNCSFISLWRTVHTSWNFFTYPIYAVYGTH LNATTMQIRVLLKNHTHCLLNGSLYDHNSTVHLHHGGKTILPCSISNVTENGELLRQFLF HLNGSHSSVRLSVHISNKNFTTTYLFVHGDPLFEDRLLAYGVLAFLVFMVVVLIYVTYML ARRRDWSYKKLEEVEEKKYPVPYFKQW 387
75 Protein UL117 Q8QRZ1 MYSNIKIVYGSPRISKSLAPANKRKTHRTIVVVPQKGLLRIPPDDQDVTHVKIVPAPSPA SRDRRASATAAGATATAAALPAPSSHHVYPYGTSLIRKSARDVKLRSKLTVFNITQPALG YYHTLTMDHAEFLSGFRQEADHQAVLTADNIPAAVEIHLTEDGLPPGTSGAVGMPSMTVA QQQQQMAHAQQPMSMPPLGQPPPYPQPASAAAALAASLLASPSSASVSPPMIDLTSHQRP ITLFTPAAAALPPALATNGGNATYILPADCRYAPLFASKYKHIFEEVARLMRVHDSTAVQ IQISASCGNAFQALKSALLKLHNITVLAGQQLITQTMPHTPQAVATFKFFHQDPGRVLEG IRPVVPRSTSYHETGVYQMWVSGATKKDLFDAVTLCASVVEKQPDVFNINVSLLTYPSIA APHLPLYNEFTGFRLPTS 438
76 Protein UL116 Q8QRZ2 MKKRPRGAWPLLLWLTCAVVLADGENSTGSNTSATTIVTTGTTRSTTTAATAASSTSVVT ATASTSLLSSSTVSQKTPANGTTTTNATTSGNSSGVTTSAVITDTSALSPSVVTTADFEN SSLSGPTTVRPSLSDLTTGWWSTEDGEDSSRSAPTSVPASLDICTQQLSIVFYEAELLLD PEDVVGDEDPSQTEVVFEDEDDEEDDDDKETQKEGKESLLFPFYLQAQCNRSDAINISTC EYSKRSPQGGSSVPGWPDIDRVDFVPRNLTKCDHGLAVIVAGNRTFYANSALTANLVAGI YNVLGLGDLTSSFLLHLRQFTYPARPRT 328
77 Envelope glycoprotein L, gL Q8QRZ3 MYDLRPPRHRLRILTVVAWIVAAAAAAASSDPACPELTRRCLAGEVFPAKDDSWLWPLVN ATHRDGMLSQLIRYPSLRHQQQLLQGQQQQAVGAVTVDDGFLESLLMLYNNPSQLRALLT LINSDAAPRWMALLRGYGQCGDGSPSIYTCVDDLCRGYDLTQLKYVRTVFSEHVLGFELV PPFYFNALLAVRNEATRTSRAVRVPVSTARSPGGITLFYQLYNLVKEFCLRHGLNPPLLQ RLDKYYADLPAALKQARVNLPARSRYGPAGVDAG 274
78 Uracil-DNA glycosylase, UDG, EC 3.2.2.27 (UNG) Q8QRZ4 MALREWMLANIADNKGCMLNPDEQARVFCLSADWVRFLSLPEHDTALLRETVAAVESARQ RGVVYPPPEHVHRWSFLCSPERVRVVIVGQDPYCDGSASGLAFGTMMGKPPPPSLNNVFR EVARTVDGFRRPTWGCLDAWCQRGVLLLNTVFTVVHGQPGSHRHLGWQTLSGRVIRRLSE LREHLVFMLWGAEAQSCEYLIDRRRHLVLKACHPSPKNTSKSFVGNDHFVLANAYLDTHY QETIDWRLDS 250
79 Protein UL112 Q8QRZ5 MDPQTTVVRKYWNFTNPNRILHQSVNHSFDVRQFIFDTARVVDCVDGEGKVMHLTKGWLC ATIVQNGEPAAGSKTQQGFMSIDITGDGDLKENLFVRGGIVSNKSVSSVVGTGGPNESAL LTMICENGSLQVTYVRHYVKSHAEAGPSSGASATTTAASSGICLPSSLSGGGSNNSGSGH GGGGGSGSSSGGLGLADEHQRRARQEQRHEERRKKSSSSGGNPDPANGMLRDPRLMNRQK ERRPENDGCSPLRDAKRQKMMATQPSQHHHHHESKSGANGGHEAESCVGMSGAGGNSGAH GGGNNGSGATTAGLNRMLPLDGGVTSEAVAFLNYSANNATEAGADGALLGCGGSGNERGE EESRPRTPKMAVAGPSPRPLRAEPVPGGGAGELVVASATATVASEVVVMPASSNCRVPPP NSQESAVPQRPRSPRFDDIIQSLTKMLNDCKEKRLCDLPLVSRIVPEARTAAPGQPPQQQ PQQQQQQSQPPRVPATAPTATATSSDGNPNDNGRQHHHTAAGASSATAAAAVTVAAAAAA AVTVASAAVAATSAAGPGLAAAAATLPLATGAGETVTATPPAAATHTTTATASRPVCQIK PYVVNPVTTRPAADEEDDAVRPTTSAGGGHRGRRANHSDAAGTGRRGRSRSARGGGGTGG RRQTSSSSTRRSRRRNARRDDDDDEDDQPGPSSGGSRRRRGPSFMEDGLEIIDPSEEAAI AAASIAAFFDD 731
80 DNA replication helicase, EC 3.6.4.- Q8QRZ6 MSITASSSPPRPARYDDALILNLSSAAKIERIVDKVKSLSRERFAAEDFSFQWFRSISRV ERGGTASGADAGRVGKSEPSTSSVPRPTSVASSVAAAANQEAGTRVPRVDRWPFFPFRTL LVTGTAGAGKTSSIQVLAANLNCVITGTTVIAAQNLSAILNRTRSAQVKTIYRVFGFVSK HVPLAEAGSETLERYRVCDAREENTIQRLQINDLLAYWPVIADIVEKYLNMWERKASLDD VSELCESNIIVIDECGLMLRYMLQVVVFFYYFYNALCDTRLYRERLVPCIICVGSPTQTE ALESRYDHYTQNKSVRKGIDVLSALIQNEVLMNYCDVASNWIMFINNKRCTDLDFGDLLK YMEFGIPLKDEHVAYVDRFVRPPSSIRNPSYASEMTRLFLSHAEVQLYFKRLHDQIRLSE KHRLFDLPVYCVVNERAYQELCELADPLGESQQPVEVWFRQNLARIINYSQFVDHNLSNE IVKERLRPAQEVVQQQREQQQEVATAVLGGGGSRSAVLGGGGGLDDVIAAEGGYVPPAAA AADGGVSPYRETLLTLRITYIKGSSVGVNSKVRACVIGYQGTVSRFVEILQKDTFIERTP CEQAGYAYSLVSGLLFSAMYFFYVSPYTTEEALRELARIELPDVPSLCFGGANNVAAAAP EQDDDGSARVSFSPVRNPVVSDDSDDGGEAEETHDIPCMAEDDLAVTDAELVDHTDLYVD PFFHKYSKPPSVSLLSFEETVHIYTTFRDIFLKRYRLLQRLTEGRFATLPLVTYNRRNVV LKPNCQISSQTGSFVGMLSYVSPVQTYTLEGYTCDNVLSLPSDRHRIHPEVVQRGLSRLV LRDALGFLFVLDVNVSRFVESAQGKSLHVCTTIDYGLTSRTAMTIAKSQGLSLEKVAVDF GDHPKSLKMSHIYVAMSRVTDPEHLMMNVNPLRLPYEKNTAITPYICRALKDKRTTLIF 959
81 Portal protein Q8QRZ7 MERNHWNEKSSAAKRSRERDLTLSTIRSILAADDRLRISASSYLAGRGGDDEAVIDIFPT GQTMSFLRLLHGFMGACRGKSMHQVLRDPCVLRKQLLYGVCKTLFDTMTARRVAEEWKLH AALFPYRALDDEDLEQYLLVWSASIRQSVETGVLGTLREILYQYADNDEYGLYVDWWATV GIVPLVDARPKEREVLERAQFVRAAVQRSTETHPLAQELLSANLALLLQVVERLCAVRVA NGPEVRVFKKVRSERLEAQLRGKGIRVYVACEPLAYERDRLLLTTPVAHLHEEILRYDGL CRHQKICQLLNTFPVKAVTMSRHELNCKKMVEMMEKHDRGSDAKKSIMKFLLNVSDSKSR IGIEDSVESFLQDLTPSLVDQSRLLPSRAPGGVVGPGPGPGGGGGLGAASSVSGGLGQER DIRDVFKKQVIKCLEEQIEAQVDEIQDLRTLNQTWEHRVHELRDLLTRYASRREDSVNLG ARDAELYHLPVTEAVRKAQEATPFRALPVEDNRLVANSFFSQYVPSTEPLERLLTQLWEN EYFRTFRLRRLVTNQGAEEAIVYSNYTVERVTLPYLSSVLGLSALDPIPEAYLHLSFGEI VAAAYDDSKFRQYVELICNREKARHRQMTRVEGAPPRPAPEQRRRGPERVDRFRNGVPDD PRRAGGPYGLH 671
82 Cytoplasmic envelopment protein 1 Q8QRZ8 MESLMIRGVLEVRTDFTKHNVMIMVPRVMDFTVKDDRLWVQTVQSPMLSMSEYRAELLHG TSFVGYSTVFLLETEDAITQLKLTDLRVKHRCGLVKPDNLMHFSLCTILSCVENCNLSRQ CLFDLLSYLRMMNVRDSFGKLLQHSARRLICSALYLFFEEKDADVVEHVPATFMLYLQAR HSCLEIVTRFFFRITRQDEDHVFSLKLTDRKTLDGWAVGLALLDVLNANFPNLPGPPKIS PSGVLTR 247
83 DNA helicase/primase complex-associated protein, HEPA (Primase-associated factor) Q8QRZ9 MAANHYTLVGASCHLSWYGILEASVPIVQCLFMDLGALGGRAEEPRLRTFIVRGDRLPSA EVRAVHRASYASLASAVADAEERRRGIEHRSAVLARVLLEGSAIIRVLARTFTPVQIQTD PSGVEILEAVPALGFDAAALSHALSLYHVAKLVVIGSYPEIHDAVATSSSVSARVATGGH EDYATQAHKKLRRGYYAYDVAMSFRVGAHKYVLERDDAAAVVSRLFEVREVCFLRTCLRL VTPVGFVAVAVTDEQCCLLLKSAWTHLYDALFRGFAGQTPLRDYLGPDLFESGGARSFFF PGFPPVPIYVVNGLHALMRETALDAAGEVLSWCGLPDIVGPAGKLEVEPCELSLGVPDDE WQVFCGEGGRAVRLNATAFRERPAVTDLLQLQQQHRRSPPPPAHTTSSSSIARAHPSSDE DDNAPSSSSPSPSPSAVVSSSTGGAHPPHDDATFTVHVRDATLHRVVIVDLVECVLAKCI RGRDFNPYVRYSNRLHTHAVCERFIENLRYRSRRAFWQVHSLLGYISEHVTSACTAAGLS WVLSRGHREFYLYDGRSGHGPVSAEVCVRTVVDCYWRKLFGGDEPGPVCRVQESAPGVLL VWGGERLVGPFSFYGAGGALLGAGAVGSGGGGAGGGGGGGAAPPPHYHVPVGCCGGCCAG GGVRDEGGSPAAAPLLLGCCCAGGDWLSAVGHVLGRLPGLLRERVGVPELEAVYREILFR FVARRNDVDFWLLQFQPGENEVRPHAGVIDCAPFHGVWAERGQIIVQSRDAALAADIGYG VYVEKAFAMLTACIEVCAQDILSSSAAPAAVTAPVPTSSTRSPLLSSVLPPPAVLSPSSV PSCSSAATVTTTVTAAPSSSSSAAWDGDDEERDEWARSLGSDARKAARRVASEGLRFFRL NA 902
84 Envelope glycoprotein M, gM Q8QS00 MAPSHVDRVNTRTWGASIVFMVLTFVNVSVHLVLSNFPDLGYPCVYYHVVDFKKINMSAF NVMHLHTPTLFLDSVQLVCYAVFMQLVFLAVTVYYLVCWVKIAWRRDQSTVLNQSTRDIS YMGDSLTAFLFILCMDTFQLLTLTMSFRLPSMIAFMSVVHFFCLTVFNISMVTHYQSYKR TLFHFSRLHPRLHGTVQFRTMIVNLVQVALGFNTVVVAMGLCYGFGNNFFVRTGHMVLAV FVVYAVISIVYFLMIESVFFQYVKVQFGYHLGTFFGLCGLIYPIIKYEQLVGDNYLPVIS WCFGAVFLIWATFTACRAIRYFRARSLFKYQALKTTSEEEIASLKHNEAAMPESDEDEES EGA 363
85 Cytoplasmic envelopment protein 3 Q8QS01 MGAELCKRVCCEFGAPSGDPLRDVMGRRVNLRGYDNMPHTSSSESDLEEDDDVDYPSADP QKRRLHPGPSGGGSVLSQKKKHASQQNVYEHPYHEPVVVFKGPGHDDGEEDGNEADRSSL STVRSSFRQDNKKKKKTKKKKTTSQQSSIMQETDDDPDLDDERSACLGGASSSPPPLPPR GGSQTTAGSGSRRLPRPATPMPSKKIKSRSGSESTTSSRVSMSSSCY 227
86 Alkaline nuclease, EC 3.1.-.- Q8QS02 MWGVSNLNYDDDEELTRLLAVWDDEPLSLFLMNTFLLHQEGFRNLPFTVLRLSYAYRIFA KMLRAHGMPVAEEFMSRVAALARDEGLRDILSQRHATEASRADIADALDRVAERHDDRLG GSDDYLWLSRLLDLAPNYRQVELFQLLEKESRGQSRNSVWHLLRLDTVSATKFYEAFVSG CLQGASSASAASSRAGVSPGIQFGLKHEGLVKTLVECHVMHGREPVRDGLGLLIDPTSGL LGASVDLCFGVLKQGGTRTLQVEPCARVYEIKCRYKYLRKKEDPFVQNVLRRHDAAAVAS LLQSHPVPGVEFRAEREVPSAREFLLSHDAELFKATLKRARPLKAPEPLRDYLSDLLYLN KTERSEVIVFDAKHLDDGTINASLGPAAGGADDEAAGGGSSGGSQTAFEDENTPELLGRL NIYELARFPLPAFVNPRHQYYFQMLIQQYVLSQYYIKKHSDPERIDFRDLPTVYLVSAIF REREESEVGRELLAGGRPFNCDHIPLLIIVTPVVFDPQFTRHAVSTVLDRWSRDLSRKTN LPIWVPNSANEYVVSSVPRPATP 563
87 Tegument serine/threonine protein kinase, EC 2.7.11.1 Q8QS03 MASSLRSRARSSSADSGSGWDPPPLQRPSRARRRNWVREAAATAAAAAAASSNVAQEAAA LAALANVTTSVGTSVFRHASSSGRNRVVSASATTVVAAATTSSSSLRSDGLSPARLAVPA VAAPASPPPTPLPADSNKENRGLSGRRSAVSSDGGSSYHGLRCRESSDMWSFEYEGDDGV TSVRGGVVGATNGGGGNSLGFGIGTNTSVLGSVLLSSRSSGDPLESGAISRRRRRCSSGG QGQRGPLVSLARTPLCRTGGRAVRVKNHVAASTFRDLDGGGGAGGDTSDSQPPPEDEDDE SATTDGEGVGVLDDPVGVGPGAAANVEPEHDDVHCTCSNEHVITTSIRGLTCDPRMFERL DHPELCEVSLSYLLVYVPKDEDFCQKVCYAVDLSDESFRLGQGSFGEVWPLDRQRVLKIA RKHSETVLTVWMSGLIRTRAAGDEQQPPSLAGTGVYRGLLTATGCCLLHNVTVHRRFHTD LFHHDHWKLACVDSYRRAFCTLADAIKFLNHRCRVCHFDITPMNVLIDVNPRNPSEIVRA ALCDYSLSEPYPDCNDRCVAVFQETGTARRIPNCSHRLRECYHPAFRPMPLQKLVVCNPH ARFPVSGLRRFCMAELAALGNVLGFCLMRLLDRRGLDEVRLGSEALLFKHAGAACRALEN GKLQQCADACLLIMGAQISYHACLLGEHGDSLLPHALRFVDNKVSSCRVRAFRRFYTECS HVMLHEYVRKNLERLLATADGLYLYNAFRRATTITCEEDLDADCRQMFPE 770
88 Tegument protein UL14 Q8QS04 MTSANKQLLKEVMRLDLERQQHQFLRRAYGSRHRLTSHQALSVMRTAVREQTHYSRLTVQ RVGAHLLGDERQELQRELARAKQLQRLDVDGALDSLTELKDTVDDVNCAFVDSVSSTCDL ELEADDAENAT 131
89 Protein UL95 Q8QS05 MMAAPSASSSSSCPPSVSRKRASRAGPSTSLQASHRVDADVVSLISSSSTSDSSPPPSPP PSSSFVSPVFSPASVPSPSPVRVASPRLRKAPASLSGVSTSLCAVERMVELSTQAPPEDF AAGETLRFEEAVNMALVACEAVSPYDRFRLIETPSENFLLVTNVIPRESSSAVEAPASVP GDDDEEGGGGEDNSSSSRFSAFRHDVLERFAVSAEAPPPPCVRDYALRNADRVTYDGQLI YGSYLLYRKSHVELALSSNKAQHVEAVLRQVYTPGLLDHHNVCDVEALLWLLYCGPRSFC ARDTCFGREKNGCPFPALLPKLFYEPVRDYMTYMNLAELYVFVWYRGYEFPASATGAGAG GAPEPSSASSSSAVPTGAAAVGDAVPDDDSNGGELHLPLKPVSLDRLREVLQVVRSRFSG REVPTWPASSRTCLLCALYSQNRLCLDLARDDARTVSYSPIVIQDCAAAVTDVTLSHILP GQSTVSLFPVYHVGKLLDAISLTDAGLITLNL 512
90 Cytoplasmic envelopment protein 2 Q8QS06 MAWGNGVCANDSRSVRQFLQEECIWRLVSKGQKHREYRAICCKSAIFSTQDDSSCILCQL ILLRRNRHEYIICLNANGKYQGHYSSPRVHRRRRHICHLPPVYQLIITGPLGPAHLDFLP RFNHVVSSMSCRGISPDTMYEVCQVVSEDEAKRVVIKGDGAVSLTGDKAVSLGGTGAWLV VRPEGYVLYFYILCYDLYTSCGNRQEMPSMARLMAAATACGQMGCTFCVDHGGHVDPTGE YAGSVSDHGGCFCYIPCGPMTQSAIHNPEPATFFCEDEKAQFLCTCGSKTAPQITLASGL DYVFGVKDAEGGWLQAKQDVWDLVKVEEPVSRMLVCSCPVLKNLVH 346
91 DNA packaging tegument protein UL17 Q8QS07 METHLYSDLAFEARFAADWQLPLHLVLDHSALSCEEAETLRYVYYRNAVRPAPPPQSTEQ GGPEQDAAEDWQRAAFRVLPRPLELLAYLRDSGLTVTLPADDPGVRMYYAVFTTLGLRCP DKRISGSQMLYLRLMWDQGRQRDWEFLARDLLREEIEANRIDRHQRELAEARAVNNRRLT SGTARPLLSSATTSSAPSHPLLGSEPAFGRSDSPAMAAAAAAAAELPPLESAAGTPFFQI PRAPAGADGGSGQSGGPSDLELRVARLLRGDPEFTYHAGPLEPPSRIRGRELVQTRVDIN PDLMYATSAQEPVEVSRTDEWKGAGVSRRREVWDVQRRVRFHVLWYVNSFWRTCGLTYDD NEADLYRALDAYRSRIAVEYVLIRAVRDEIRLVLQHRRALRQLFACHVVRKMSWIHVWEL FRHALELWIDRADERSCIIKALTPRLGRPARAPTPERLDRDASALKPYPWLAGRGSLPEE PERVWYADVVRCVRAQVDLGVEVRVRRCRRTGLWVARDRRGQLRRWPSQAEVCVLYVTPE LHFHWVLPGGFAVSSRLCLDGLGQRGLRERFQVGEAVFTRGMHLATGLQGPEAPRVSGNL LQVGDL 606
92 Protein UL92 Q8QS08 MCDASGACDMRHVHNAFTEEIQLHSLYACTRCFRTHLCDLGSGCALISTLEGSVCVKTGL VYEALYPVARRHHLLEPIEETSLDDVNIIGAVLSGVYSYLMTHAGRYADVIQEVVERDRL KKQVEDSIYFTFNKVFRSMHNVNRISVPVISQLFIQLIIGIYSKQTKYDSCVIKVSRKKR EDALLKQMRSEYGNAPVFGSGL 202
93 Protein UL91 Q8QS09 MNALLTELNRLGVAHASSEDVFLFVDRLFHNFAFLFQTEESSPRRLELVSGLFEHLTVEC VNDIVDACNHPDVPGTEGGGGSGAAGGGAAAEGGAATNAPVPMSTGNVSPSVVSSSKLSC DSPVFVPASATAAGCATPRAPAT 143
94 Tripartite terminase subunit 3, EC 3.1.-.- (Terminase large subunit) Q8QS10 MLHGDSAAKIQERYEELQKRKNHPTSCISTAFTNVAALCRKRYQMMHPELGLAHSCNEAF LPLMAFCGRYRDYHSPEEKRELVFHERLKSALDELAFRPCPEEQRASYQKLDALTELYRD PQFVQINSFMTDFKKWLDGGFATAEGDAKPIRLEPFQKNLLIHVIFFIAVTKIPVLANRV LQYLIHAFQIDFLSQTSIEIFKQKATVFLVPRRHGKTWFIIPIISFLLKHMIGISIGYVA HQKHVSQFVLKEVEFRCRYTFARDYLVENKDNVISIDHRGAKSTALFASCYNTNSIRGQN FHLLLVDEAHFIKKEAFNTILGFLAQNTTKIIFISSTNTTSDATCFLTRLNNAPFDMLNV VSYVCEEHLHSFTEKGDATACPCYRLHKPTFISLNSQVRKTANMFMPGAFMDEIIGGTNK IAQNNVLITDQSREEFDILRYSTLNTNAYDYFGKTLYIYLDPAFTTNRKASGTGVAAVGT YRHQFIIYGLEHFFLRDLSESSEVAISECAAHMAVSILSLHPYLDELRIAVEGNSNQAAA VRIACLIRQSVQSTKLIRVLFYHTPDTNRIQQPFYLMGHDKALAVEQFISRFNSGYIKAS QEVVSYTIKLNHDPIEYLLEQLQNLHRVTLAEGGAGSYSAKRHQRFSDDLIIAVIMATYL CDEMHAIHFRVS 672
95 Tegument protein UL88 Q8QS11 MMEAAASASATASRLGGGATGGSASSSFLEEDDRLAPGWRDAALVQGDGSVREHAFKNVA LSELVRRVIPPPPDADEGVVFASELSLYSSGRVSRISSVFSIYWQGHSELVYILTGLTHC TKLVVECGQMKGTVTGDRGWDGDSRHRHSISSPHHSGSSSSSHSHRSRHTGYSNSRPRHS HSSGSSTSTTTSSSRDTSSGGLGDRDDRGRGAGSGAMAVEDDLLYEVPGIYMIRVSDGNM GPRNVVWPKTSVLWAPDVEISTVRRHSAAVRAFASALRNYMFWMGRRSQEELEVCPPEVE DHLAPLLRGPTRGDSEIFDGLVGSAYQRLRQSDIPRSSSLLLEHCVGMASLKKLLLLDLP RLENFYLCQVCLYELDEDEVGEEMLGMLAGRPGDSGDAAEFFLHRKTMKVAACLALMLNC LHKYQEGLSTIEQLQSVLQQQRLDENDLILVALRRYYRHRTGVHARTLAAAKALISEFAE NFSPMGSYTRLGFDRLGALDAEVSIQDLVAVLRA 514
96 Protein UL87 Q8QS12 MAAPPRRAGRDALIVESPAARRVLNVPVHVNSYNLTQELSTGEDARFCRPRPVDAERVRA VFAALYRACPAHVRAEADRVKLVLGRLLLGPVAVPCYCDEWVTAGEEEDDDGAAARLLRE HLAETAQFCRGPLLYVHRRCRCAGGGAQRPLAFSVMEGHVATHVFRGLLSLAEWNCQLPG LFCPCVVGGAAAAATERYALACLPRDLSLHMDDYPYLMVEIGRVLGVSEVDDYVGALSGY LGEAAAPRIQVHYKLLFGLNVRPQAPCALSATGDFFLLELQKLWLGVEYHNEVTAEFFGR VLAQLHRERGRVMMALRLPEQTVCHLSAFVLSRFKRQVLYFKLQVSYGKYKHAHASGLHP NLLCYRRLSVTFADTDTVWRNLFYVYYELSRDVSAGASAAPGEQKGKKTATKEEEGEQEE KNGESRGHHGEDDDEDEEYQRRHRLSSSGHGVGGRGRTQLLVAPPPPVTSLSGRSHDVAI SVPPSSTSRLLGGGGGPLDAVAATAARAGSGRRGGAAAGKGQRDPSADRIRRYVCIISRL MFARYGERGRRQRQRRDGDADGSGAFDFTGQNLRRAYQEHRRRRHLAVQRFAPCRRKLIG GMEFAEVTGVSLDRIAVNAFNTNRVINMKAALSASSASCAGCCRLNRLPKNMTHSFVMYK HTFKEPACTVSTFVSNDAVYLNSLNVNIRGSYLEFLYSLGVYRLHVNIDHFFLPAVVCNS NSSLDVHGLEDQAVIRSERSRVYWTTNFPCMISHTNNVNVGWFKAATAIVPRVSGSDLEA ILLKELSCIKNMRDVCIDYGLHRVFTQLELRNSYQIPFLSKQLILFIRVCLLKLHGREKR LYLDRLVFEAAQRGLFDYSKNLTAHTKIKHTCALIGSRLANNVPKILARNKKVKLDHLGR NANLLTVCRHVEANKISRVRLRVLVEVLSTLQGISGTPHTREVIRQTLFRLCGDAAGSGG GLFGASGQPSSETAVGADVIFASGLTSSSPPPPPSVPPSSPVDTRR 1,006
97 Major capsid protein, MCP Q8QS13 MENWSALELLPKVGIPADFLTHVKTSAGEEMFEALRIYYGDDPERYNIHFEAIFGTFCNR LEWVYFLTSGLAAAAHAIKFHDLNKLTTGKMLFHIQVPRVASGAGLPTTRQTTIMVTKYS EKSPITIPFELSAACLTYLRETFEGTILDKILNVEAMHTVLRALKNTADAMERGLIHSFL QTLLRKAPPYFVVQTLVENATLARQALNRIQRSNILQSFKQKLLATLFLLNRTKDRDYIV KFLTRLVEAATDSILENPTTYTTGSGAKISGVMVSTANVMQIIMSLLSGLISKETVSAPA TYGNFVLSPENAVTAIAYHSILADFNSYKGHLTSGQPHLPSDSLSQAGAHSLTPLPMDVI RLGERSVILENLRRVYKNTDTKDPLERNVDLTFFFPVGLYLPEDRGYTTVESKLKLTDTI RNALPTTAYLLNRDRAIQKMDFVDALKTLCHPVLHDPTPCLQAFAERGPPSDPMMQRLLE SRFQREPMGGIARRVGHFYRVRREVPRTVNEMKQDFVVTDFYKVGNLTLYTELHPFFDFT HCQDNSETVPLCTPRILVGNLPDGLAPGPFHELRAWQIMEHVRLRPPPDYEETLRLFKST VTNANYPELFYLVDVLVHGNTDAFLILRNFVARCIVNMYQTRSLLAFAHSYSLVTLIAEH LADGVLPPHMLFHYRNLVAILRLVTRISALAGVNNGQLADEPLAAYVNALHDHRLWPPFI THLPRTTEGVQIVADRQPLTNANIEARHHGVSDVPRLGAMDADEPLFVEDHRASDDEWTL QKVFYLCLMPAMTNNRACGLGLNLKTLLVDLFYRPTFLLAADRQAASTTATASATGTAAA SSGTATSGSGSGAAGDDGAGSAAAQRQQVGELLSELVEDIATDAHVSLTQACRELFLAVQ FVGEHAKVLEVRAELDHAQRQGLPDFTSLQFVLYNGCCAVTAPKIMVEYCLAVPFHRFYS DPVIGSGINDDIKRYITDFPHYHRHDGGFPLPTAFAHEYHSWLRSPFSRYSATCPNVLHS VMTLASMLYKISPVSLVLQTKAHIHPGFALTAVRTDTFEVDMLLYSGKSCTSVIITNPIV TKEERDISTTYHVSQNINTVDMGLGYTSNTCVAYVNRVRTDMGVRVQDLFAVFPMHVYRH DEIDRWIRHAVGVARPQLLDTETISMLTFGSMSERNAAATVHGQKAVCELVLTPASADIN YYKITNNPRGRASCMLGVDPYDTDAATKALYDHREPDAQTFTATHNPWASQAGCLSDVLY NTRHREKLGYNCKFYSPCAQFFDTDEIINSNKTLFKTIDEYLLRAKDCIRGDTDTQYICV EGTEQLIENPCRLTQEALPILSTTTLGLMETKMKGGAGAFATSETHFGNYVVGEIIPLQQ HMLFNS 1,386
98 Triplex capsid protein 2 Q8QS14 MAAMESTIFCTFDHKLTIADLGKLAKLTAAVVPIPQRLHLIKHLQLGLHQYTDHTRGYPR MRSLLRNMTLTLLRRVEGNQILLHVPTHGLLYTVLNTGPVLWEKGDALCLLPPLFNGPMA RENLLTLGKWELVLPWVIPVPLAQEINQRLLIMGLFSLDRSYEEVKAAVHQLKTITYRDA TFTLPDPVIDNYLLLDMKTACLSMSMVANLASDLIVTYVRKLALEDSSMLLVKCQELLTR TDRERGGERVPPRPNHVSPDEEISRLSALFVMLRQLDDLIREQTIFTVCDVSPDNKSATC IFKG 304
99 Protein UL84 Q8QS15 MPRGDPTLRNRARSRARKGPLTPSRQAHRRYRLHGSGGGGSGAGGNHHSDALLPAHAVGP DDDTILTLTDKHNAKQPLTHRGTYHLIQLHIDLRPEELQHPFQILLSAPLQLVENSAARR QHATASEERTAGNEEKEGAGEEEEDEDDRNEDRERGILCVVSNEDSDIRPAFSLFPARPG CHIVRSMIDQQLAQMAIVRLSLNLFALRIITPLLRRLPLRRKGTHHAALHDCLALHLPEL TFEATRIAGGSGDDDTPPATDTELTPSLTVQVRHALCWHRVEGGISGPRGLTSRLSVRLS EATAAALGPSVFGRLELDAESPADLTLSSLTLYQDCVLRFNVTCDRSEGPSDPVSFRLRL RRETVRRPFFSDAPLPYFVQRPGEDGLEVRVPYELCLKASHTLRIYRRFYGPYLGLFVPQ NRQGLKMPVTVWLPRTWLEITVLVSGNHSNAADSSNASGDGVVNHSNHHNQSGQDDDGSG GVSLPRDSVLGRLYFISSKHTLNRGCLSALTYQVKSALHNRPAPQLSVLGASIALQDLLP MRLLSAEPTQEQQQTPATEKPSPVTLAMICGDL 573
100 Protein UL95 Q8QS05 MMAAPSASSSSSCPPSVSRKRASRAGPSTSLQASHRVDADVVSLISSSSTSDSSPPPSPP PSSSFVSPVFSPASVPSPSPVRVASPRLRKAPASLSGVSTSLCAVERMVELSTQAPPEDF AAGETLRFEEAVNMALVACEAVSPYDRFRLIETPSENFLLVTNVIPRESSSAVEAPASVP GDDDEEGGGGEDNSSSSRFSAFRHDVLERFAVSAEAPPPPCVRDYALRNADRVTYDGQLI YGSYLLYRKSHVELALSSNKAQHVEAVLRQVYTPGLLDHHNVCDVEALLWLLYCGPRSFC ARDTCFGREKNGCPFPALLPKLFYEPVRDYMTYMNLAELYVFVWYRGYEFPASATGAGAG GAPEPSSASSSSAVPTGAAAVGDAVPDDDSNGGELHLPLKPVSLDRLREVLQVVRSRFSG REVPTWPASSRTCLLCALYSQNRLCLDLARDDARTVSYSPIVIQDCAAAVTDVTLSHILP GQSTVSLFPVYHVGKLLDAISLTDAGLITLNL 512
101
102
103
104
105
106
107
108
109
110
111
112
113
114
115
116
117
118
119
120
121
122
123
124
125
126
127
128
129
130
131
132
133