Chershoee
id Protein Name UniProt ID Sequence Length
1 Membrane protein A20A G8XSV4 MWLTVAIIATAFTTIASAFFGFNSIFQILLFLIVVISVAVFTLNLVALLIYDFVIDTMNE LFLFKNQDDIQNEKTEVSDTMIIIFMET 88
2 Membrane protein S33 G8XT59 MKWAIVIIHILFGALCCRGVVPGYFFHEWMLEFFSPDQITSTEKTQSSESPGSKPHAETK SGPKIPTPEEFKKFCDSGKHNLTDWLTSPLRKLLLTRYATNIHFEVDEYCKHPCVGGDDG CYIQKVEGECKLKDGDFSVTVVYTGNFYLNLTITYFVMQDYVGNAKDLQDSAFLERLTDN KYMLTYESPVRIVHVKEIHLEVCPCEVCRRQYFTCIVSTKVTISPFEYYGLGDVIHLWLE SRYWEFAWVYILIMIRLSLCCMFLGDIFGILDRMQGWSPLKIVLYIWGQLVFWVILLYLV SGELDALWYYMLPKGQW 317
3 Membrane protein S32 G8XT58 MDPKIYLIFSLLIISCSSMTMKEEMPFFGNEDDNNSDVGSGTSDDVIFTSPSASTNLQPT PSQYKELCDTGKKQGIDWQNNPLRTLLLSSELSETDIYDIEIYCSSICVGDWENCKITNV SGKCNVKDSMLNIKIEVKGIFMENLLINYVALHYYKSPIMNLRDLIVLTRIDKNTYWLQY DNITLLDPKALQLVMSPCYLCERKDFVCTISTEVTVLPLDCSLIDFVHIYLEERYLLALW VYILLCVRIFLVARLLESYQCFTLESSSGWKLFAKLMGVMIVSVITVCIATGDIYAIYKF LLQNGVS 307
4 Membrane protein S31 G8XT57 MRCLYLLFLSTVVFAIFTSQDPDDYRFAREGGNVTLPIPKVPTEKPTRIVWSFYNVTNKI VERDGVMLRYYGTYLQRFRLNATTGSLMIRNVTKRDAGTYYVRTVTSRSDQTRSVVLIVY FNLLTGPNVTMTAKNINGRCEFTGYCSYNGSCHPPHTNCSWHVLSNGTYRPLSGNNPITV SIALQNSTRCYMCNVSTPYQHRNSTICLSSCSSSSLLLSLHQEPRTTKRPTTTRTTTRTT TKSVTRSSRTTKPTSKPTTKTSRDPRTTGKSKDFSSGPGLPTDTLESTPFPSLEDSTPCT TCNVSFEARAARWHWGIGFFFMMLLIIIIIILFLIYRRRISARYNVAQATIRGMLRRS 358
5 Membrane protein S30 G8XT56 MWNWIWTWIVLSMSLADESIYIVNAYSGRNLTLSIPGRVTETLDDITWLCTDTQKIAEWE GSTGSTYYSSFQNRTHLNGTGILYVSRVYPNDSNLYIVQITNTTQHSRRWSFNLQVFDPI LQPPNITFNVTRRAKGCNVRLFCSGINTYNTTFVNYTWYSLSSDDLTVISRNESYIRNVT TDGCYTCQIQNPIERSNSTYCTSSCNVPLSQRYFKKWSPSSIITLLSLSVLLFSFLILHV YRKRL 245
6 Membrane protein S29 G8XT55 MSHKSRFFSSLDLEDHLTFIRSMHNGKIAFVTMDFEKTASKSTITQTSKAYRWKDVLHTL HVHYDTSSFDLFFWIAFYVVFTVLISLMVLHVPTFNMLNSWRYSVFLLIVVVILYILLDN WDLGLLWTHVLMTTCSTLAGITTAGLLLFETESSTHFCYIMLHVTITLQVYRTEQYLYPL NNRQRLCTCAVFCMGLIWLIRRPWAVQKLTSTMSCVITMYVSMMDDAYYRQRARFRTPYV LRRVADWYIDLLMYGYTAIMIQNIERE 267
7 Protein S28 G8XT54 MIIASNLITMTVLGFKAARIAYDDRKQSDLKHILVTCPKTWIGFGNKCFYFSEDTRNWTF SEVYCAGINDTLAQFTTMEELNFLKRYKGPSEHWVGLRRQSSNHTWKWIDETEHNNTFPI RGVGEYAYLNDNGVGSASVYTDRKWICSRMFNTTVACHTSQDSSVR 166
8 Membrane protein S27 G8XT53 MMPECSLDECQAVVTTNTKLAAAPSEERVMSPQLSKQHKRHLCLVYLLFLAELWTTIITV CVWQIPVLHTIMSKSLIPVSCHFALTFLMFIVITVRNPEYPWSLTTSAIFVGMGIGIGGT TASFIRDYADSLSAIYSGTVLICLLSFCVVLHVQHNLLYFTLPAMLTAVPVIIIIGSFAE FWNIPSLRGFACMIGVISLCFSITSELYIQWRIPVQKQKSSMTQAARFYLTVHSLSYAIM FTDKYLTLK 249
9 Membrane protein S26 G8XT52 MKYQTKPGLMEKGEALLVEPTSKIPRLWKLMADLFVRPSYEDPNHRRQDRLNIILKWLFV TTWISLITMEVLYIPVIYDAIIMRHHCILLITSMVIAILIHVILDWYKAKYPWPMWVTIL NTMMSILMGSAITILTSFFTMMDALFSSLMTMTLCTLLYRYVAVTKHNLGYVKIANYVFI PVYFFIPLLWYLYGIRMLKIVGLMIAMGSILMTTYELDQQQHLLPPEFDSLLKHAHNLYF GGMSMYYGILLLKYGWQHPVN 261
10 Membrane protein S25 G8XT51 MRPWFNSRQVKSQTCRLLTMKVAITLITGFLSYALNLIDDVESANTFITIGSILTAIGYV FIVLSNPSYPWSPCSLLCFSMISIGITLITVSMYASYGIGFNLAGYLYTSLLSILAFYMS PKKFSRISVIFIVTIGTSLQATVVMMIYYGSWLSVNICNVIILYTVLMYMCSFQKSESTV SCMTKTTLFYLTFNGLLYTVNSLRLLVHF 209
11 Membrane protein S24 G8XT50 MRRRDTSAAATGSALCGNILCGDRLRCRKCRYRSEELSTPNQHRHQLCEIYTLALLELGI NVLTGFVIDVSGFHHYVQTYNNHFLFLGTFLTMAAYLSIAVYDPVYPWSTKMRLTFFSIG MSSSLICMSKVYTSYALRIIMIDYVHAFLIYWSTIWIVNIKKLHQKLMLKIILTLAVGNV IFLVVCLTWKPMLYAFHVIAIAFIYVATVNEMLLQWSQRMPCSQMLHAANSYILFVVLSG LVHSLRYYSSLSWLFLQ 257
12 Membrane protein S23 G8XT49 MDLTKGPLLQDNKKYPETEAAALHLESRTDPMEKVSTDEESQNTPRNSRESRCRRLRSIY SLVAVQCLLAFIIGLIIYYNSNIYCYVESWDEIFYIGPSSAIITHVVMTKLPRQRVWSNV VLRSAFFAIGLETSLVMVRILSDLTMQFVMVAYIITLSVFLLAFWVSVTRSRYVKLTKFI ATTGALIIIVLYLFSSWNDYILVVGCIFLIYYVFNLMVNEIDSQWSRSEFTEPSIHHATK VYLQWTALCYAVIATMVWFTVWGKSKFARFVFKTRT 276
13 Membrane protein S22 G8XT48 MIKHSSLDMKNKTSIKHQKFTGADHTLLEKRRQRLSFIYLLCAIQFGISFLTGALIRTTS ILYRYLQTENWIVYIGAVWAWCVHSWIVHSNHQISWSSSSTWLYFSLGIDAGFLTIRFVP YYDLGDVIWSYVATTIMFLLSWYTATSKSDLKLFGYVSRTQPWIMALLYAMEVVWGSQVM FIIATLLIFYLFCNMTYELYFQWSTVLPPDSPVRHAATLYFQLFLTQHCFLLSLNYL 237
14 Membrane protein S21 G8XT47 MKLQTVGDTLVKSKTEDTECVTVEISTTILETASVQTEHLPAKNSERTEEQRPEHLRQIY SLLIILIWATVLIICALCSPGVYEYLTGSKVAVYVACVLAGLSYGFIGVYEPRYPWNKIA ISACFIITSNMSIVTIKLFCGSTINIAIIVSGCALVIDLLAFYIAYSKKDFNVTIPRVAT YGIPLLSLLIVLWILRGIQVIPLISLTFTILIFLSMTHEMYNERYGPMKKQRSPMSHALT LYLYVLVTHYSVLLLPYYLECINKI 265
15 Membrane protein S20 G8XT46 MEYNSNLNYPEDSTIICARCKKKICSKCGRAWPLVSTREMEATIRLEHLHRIIWFLGYQF IWIVLVTGLLTCIPSWYKLVYQNDGMIVLYTLLNIILLFNMDHMHDHLSNFILLTWSAVL IGILITGVTLFHSWTEIKEAFMLTVIIVIALATYVHRRERDLNRVLDYLSIGLCAITVLG IIWLLRPWASGKLILSSLCGILTCLITVYELHVERWFPIGKQRSAMLRSATLGMHIFVFT CSILVIRHLVFRST 254
16 Protein US26 G8XT45 MALQSSYRYVSAQAVRRTLRSFRDFILSQDSRYKIRNLVYERYEERRSTAIPAPLGWRLC YTPFEVIFGTNGDDNSPLPWESFLCCDNPLEVLGILRYIKPVSDTFNSSDSEDEDFEAIE SNSDTETSSAPVLLMGRYETIWCFDRVDTVLFLVATSFDSLARKGLLHLDILYRHPFMPS FTESHSQMVTELIQASKSLPELRRVLSKYRWQMIPLRTPGEQTRVLQLCSSPFDIQAFWP FLCMDAESLEELFTILAEQLCCRGVVIGVIGECLPSGVFHGDYLILADEIGCVYYFSLFV SEMWKLADNLTMFFRIGLMKLYTKGRRFSTARRDAEELEVPGQCPHTMHHFWDRYSHIEY LSGSRNYQPRYRWLTRPDRFEENRTINGQFHVGEAAVGAADGSWDPRHRYDLPQEAEVKV ALDNWQRYTRSGLSLPYPPKTLNYAIGIDETLETEMQRYHKTTETASSTFFDVDEDPLLP RDILLRRVARTIIQNGKSPVYPPIPKPGSYLPPWL 515
17 Protein US23 G8XT43 MWRTRWDKSSGLPRGHAESILYCHTKRSVFLKVMEDFKDIFIHQERFSVIREFVRSNVDR RLSLGIPHNWYLQLQPEEVLPELNDRFFDDVLCCEEPLMILGQCIITKGEGEEEYEHTGI FMLLGDKGRLYLYHQEDEVINMVAENADELARFGLLGCEMIYRQPSMPYATAVPDDLVQG LLARAHDPQAVNAYVSVHQERDVSLHTPGRRAKVLKLLPHFGVLHDYWPFEAVDTCRLIA CHVVITLRLKCRWHLLGVIGSYRCNGVFLVSKLIILDRFGRVYVVTIRNGTFRTWSYKQS GEVYRVAGNLHEFFKAGFVKLYFRRRHEHYLRRVAQLERRPKCIHTPVITLPQRTFLQLG LGHDMEKQFRWLCREGRFKPEMLMTWDTWDAFALWQDRISNGPPMASPRPERRQSIQRYG DNNNEERSDDDDDEGEAPRRQGGRNRHADDMDEEDETDSDEDEWEDLGFDVTEDIIFEDY EDADRDLDAEVLEWWFQQKKISDDYMKEESVSEAEVEARRINTMDEPQPPEFRRVFDFRE FYE 543
18 Tegument protein US22 G8XT42 MPLTSKSTCVAWTQYLKSHDDRPEHVVRCDFGVAYTRRSVFQQMMLMLHGLFIRMHDHSA LRDYVQKNQGVAICLRNPGTWFLVLRDSSDIAPVRGRRLDREYLCCDENLMTVGVLAVRA SGGEDKILSETTCVMLLGATGAVYVYDWKVDALFQVAQNLEDLAENGLMWCDSVYKHPST PYSTVEPRYHVDRLLSADCRDVKALAEIALDLKGLNLVITTPGENTREPLLLLGDVNQLR KSKPFVAMSDEAFEEMCRRITCRLCCQWHVLGVTGYYMKVGTFATMAVVILDRFGAVYAL KSEDGDLHRLADDIQMFFRIGYLKLKGSYRFDRGCRGEALLETKPHCSHWCSRDAMPAYK QYPITQEEMESCFDWLTRPTLMREELQFDDVLGRTDMVPTGTLMENQNWTFPVGSIQTLP ENEDGAWQEDDIITTAFDGKRCFRAPRSFGPEEDEDEDSCHDAIVHDIGSEPNDEHRSPE KVPLSPPSPSASESSEISSTSKIHPELQKHDTANWEEVTLEKEAWKHRVIRAQLMWRYQC PVPKVSFPNYFEFPWGSPSLM 561
19 Membrane protein S19 G8XT40 MTVSSLKIDMGLETSWQRDIFKTWLLYQRMLWLRFDFIIFLRSYYITTMMLAVYVIIDQE SIASGQTIIFRKCVAITFEITAGINCFLMLRAHDRVQMALTFCALTLSKILSVTMLTRIS PLILGEYMGVGIVLVATFICNNWVPVREDLTIIEVACATVISAAVTIYSITDDYFSPEVQ IVVLAIFEFSIYFGIFWEQCRLLLMHSQLKLLQQGLLIAKMFLYLMTLHVAISMTDQVVF LNPCTFGFCKMVTLPAPEDHF 261
20 Membrane protein S18 G8XT39 MSIITDIPSKNTDCSKSEADDVRATRLQFQMINVQEKLISQWNRLMSQRPGVIILLRMYT GISFMVWTSFICSGVLNYNEYTVITAHKTTVIIISEVIAVSNCLFLTRCHLTPLRIGCVI ILTISKIVSLSLLTEICWQALLPWILGLGICIIGLVILIYYFDHLSSGIPSLVKSGHLML ISLTITICAAINDKNSIMQVIMSLCLLMTYMGGMVEHYDVWTKTTAPNETEQLNIIVSSF LYLLDAYITQYTIWHSLRYTQCLFGWCSFFP 271
21 Membrane protein S17 G8XT38 MTIPVEVTVLKTETVEKSVTEERTSVQSRSNTTIWQERITSMLTAYRNLCKERSQLYLPR VYSRLLLFMFIYPAVSFLMRQVSVQVNYRYSITAVLSQLGIIFWLCTFQCRNAILSHVCL VLMVACKNTCVVFSQNIDLKMSGIVSLGTGLVCFVVICISRFTPRSENLAPIPRTCILLM SSSLSISVTCLSQISVDVSHALTMILLGMVSIFGICDVKCLHEKKPETSLNEEVMITTTL YLYITDVQLGLRSL 254
22 Membrane protein S16 G8XT37 MTVPSSIQTAPEKPSEKHHATIRKHQTTMVAMWEQSLSYLDQDLWRRLILLWPSCSPGLV AHVYLLFGTSIICSLVIGALWIYWDSEQLTVLGDLSTAMSHEILALVSWFLVIQAKSGTM SSFFLGGLTVCKTTSVIATVNNFKLYTLIFPATMVLTVFIMLIPCSRVIPSIRPITFSNR PCVAALSVLVSVALGLDLIPKSLRVVLAICPPILLNIFIMQDHYALWKKSSEPDSEPVNV GAVVGTFYMAVMDSYLCAYYLWFVTISSLSWIWGLSIPQ 279
23 Membrane protein S14 G8XT35 MGCEPVIKTRSKQPCRPSRSRPQSVAIRIENRSNRPRERFDGWPCWAVRLLFEWRELCLL RRVFGLTCLALLSCFALCFTWSWLRIGKPWWTQKIDHEIGLSLILEVSSLTVWIWLKHWR NILLRLWFFGTMITLKVTSVNFNSHSIDTLSLPICVSIILAYFFIVTGFETFGGILRRDL PKMDQDTMWRWTIGISIVDFGVICAQNHLPSDWYTVCQCVLMMVWNAFVYQEVCWLLCIM DKTDPAMDLVISGNLCMYSLNMYMCNTNFWSR 272
24 Membrane protein S13 G8XT34 MKMTSRDITIWVTLALIYRIQSLPLPTSVKEAFGPQRPTYEEYLQICSTSSDKVLRSALT RLSIEDDTLDREQRNEIRQTCGSSCFGRCGQDLMETQCTISGNDMVARFWFRGVSDVFVT SAYIQMGGGRNVRDLRKRLRKQQIQEDMYVLEMDDVIEDLSDITVSFVYIEVQMCFGCEQ WYKCQLSTKVSWWPFDYNVKDVLRLWMEGRYVAYVWTYMFLLSRILLFTYVLANLYNIVD WLLRRSKVFVLFVGGVFFLLFFLFICPLYEMRLVNDWLSV 280
25 Tegument protein US24 G8XT44 MSVFGESDERFALELQQKVLRDFRGLFLSVTPLEVMEYVRINHGKFLCLGRPGKWYVILN SNACTVDVKNSALRRLCCAEPLCLLGSAVVMLEENPSHDPKDYIVTQFLIFWGSCSRVYA YDTYQECLLLVAHHLDELARYGVSQSEIAYRDTVHQALRRATGTSYGPPKSGKSMHILFM NSTTTEGTYATAERFQGNDVKLQTPGYGPVILRLCKTVTRLRNMWPFCTLTDEESERWWQ NMKANLATPWYILGAVGTPRAGRPFHVDLLLFLDWFGAVYLLQIEDPNHYIRRIADSLTE VFRMGLLKYVFHNRRFDEENNMKTRLEFAPICPHNEERGVRRMREILFNKNKLNSHDQQR RQRRVLRQHYEWMCLKDRFDPHQGVWEKLDKNTLVIQRFDCNSDTYVVDPDVTGLAEAER QASSSQDSGPRIHCLIASRFATRDSRRRVIPGLVSQSRYITYSNPFPLKPLAGLRDPSLQ FDN 483
26 Membrane protein A32 G8XT41 MSIPTIFLSALVTSLFLPVFANTTSTSSNNSTVTPNVTTPVAVTNLTTNVTVNSTISTVV TTPFTSTSTDEGSGDETATPSSNNSSDECEAQKWIDLLYNTTVNLTGCVLNQTWLERPHI SYCDKYDVPWMVLGRDDRPLPSGKTVPLAYEGLCCVIEGQANFVFLIRHWYGGMTHHNAL RVDYNCSWHTRLMPIYPMLTNFSIMAENYMATMRKHRGTSPCKGKRVYYYGLQHPDEIGF DALGHVELRIKETTFPWPKKQTSGPFEAPDKDDTPLLVYVTEFIILCGLASLFLYLILKA ISGYNGIWSNFRSPQKPWEPPTRRKKRFNKR 331
27 Tegument protein IRS1 (Tegument protein TRS1) G8XT60 MSGGAEPGRLSAGAAAPSAPSAASLVSTPPSPRPELTEDEFRALASAWAGAFLANTTARA TRRWCQREQGGVLPLGRPHGFFAVVTPRSQMPGVGATDLRQMSPSDEWIVLVATVVHAVP SAAQDRAHAARLEARSPWTSDGWCRTDGLYLGVGPRFRVFLLDLARLTLHLAARDADEFF RFGLGGVSRLYACDLLPRSTTEPARLSEALAAASRAAHAAHAVAEAHAGHELQLVTPGRP AQTAVLWPRWSDLRNVWPFCSHARPAELVEAARRHVTQRLCCAWYPLAVVLSNLPKESIA RVPLVALLDELCAVWAYCTLDGQLYPLADDLGHLLRAGTLSLLHLGRTASSSETETAFRL LPPVDREFWETPRADALFLHPRAHQQLRDPGSQLRFLTRSDRFQGLAAGAGAVGGGRSGE RDAGLRARDAELLGLPGLCQRSPPRSPAAALSHALRHDRDRWRPTRAPDPRTAFADPDPQ EYPRGASRPEDVAARRLSKFRARDSRELLRPLPRPPLETTPEPPIAAAPSTSSAAAAAES PAGSGAEAGDDADDAAASRGEGAGGEVRGHAGGQGGQGGGGGGHGAQDSQQPAGGGPCGA ALAGPCCCDCSCHPARGPPAAVQSARQLGAAWRTLSREARQAREARQAAAGGGAGGPGAG AGAGAGGGGLCGGVQRMALSLPGRECQTR 689
28 Tegument protein IRS1 (Tegument protein TRS1) G8XT60 MSGGAEPGRLSAGAAAPSAPSAASLVSTPPSPRPELTEDEFRALASAWAGAFLANTTARA TRRWCQREQGGVLPLGRPHGFFAVVTPRSQMPGVGATDLRQMSPSDEWIVLVATVVHAVP SAAQDRAHAARLEARSPWTSDGWCRTDGLYLGVGPRFRVFLLDLARLTLHLAARDADEFF RFGLGGVSRLYACDLLPRSTTEPARLSEALAAASRAAHAAHAVAEAHAGHELQLVTPGRP AQTAVLWPRWSDLRNVWPFCSHARPAELVEAARRHVTQRLCCAWYPLAVVLSNLPKESIA RVPLVALLDELCAVWAYCTLDGQLYPLADDLGHLLRAGTLSLLHLGRTASSSETETAFRL LPPVDREFWETPRADALFLHPRAHQQLRDPGSQLRFLTRSDRFQGLAAGAGAVGGGRSGE RDAGLRARDAELLGLPGLCQRSPPRSPAAALSHALRHDRDRWRPTRAPDPRTAFADPDPQ EYPRGASRPEDVAARRLSKFRARDSRELLRPLPRPPLETTPEPPIAAAPSTSSAAAAAES PAGSGAEAGDDADDAAASRGEGAGGEVRGHAGGQGGQGGGGGGHGAQDSQQPAGGGPCGA ALAGPCCCDCSCHPARGPPAAVQSARQLGAAWRTLSREARQAREARQAAAGGGAGGPGAG AGAGAGGGGLCGGVQRMALSLPGRECQTR 689
29 Membrane protein UL148 G8XT25 MLLLTVITSHQKLLVRIVLLYLISKQIINSYADTVKVDYVYTGGHALFHMNISVRDYVVR KVGWMACRTGPLDNCVNLWILGIKEDEECAIPDKKESLCAAATCLPNKIVELAWGKNNHP LITHTTDCHDRLETYYSNLTLEMPGIPDNVGYFTPFFKLKKTVPNKDGSYHTESMIGQFA LILRTDTTLQCLCTEMDAHFMTYNVTLQPELTATFIVTISPPEKRYTIVWKSPEHNGLYL AHGDIPGVDVTIIAVQNAIGVAFQIRIIDADNSKTVHVEYNLHFIDHHRAHEHATCQPLQ KPNTPLPHVEQKTAESHSDPPFDLTTCEWITLIIVLLVFVFMKYLPRNR 349
30 Envelope glycoprotein UL132 G8XT24 MNTTMATNVTAAAVNGTICNTGTSLIDAVLKVAPFIIYCVTAFSLLTLIVVTASALYSSC RTNRSDYDPDLSENPFDEECANLIKVPQRSRSTPVMSAKYQRLKDDDSDHEPESPTVILF NENYEHFDSEKKELRTATGVAKIEPLIDAANGAIRYYMSTYEDFKRAHEVTLPIKINVDL ADDENSSSSYGTKILEEVKLRDPEHD 206
31 Protein A26 G8XT32 MWLLLLLSILTVGVTTDAKQHDAWPGLILDWLEAWLGWIQSASVSVSISVSGEMMSHDSV SAVTEASHNGRSQTSTVVSNTTAITTERSNITTVSTNISAVTINATSAAIKSTAVINSTV VTTPNVSVFTTEELNNSMTTVAVSAVSKKPQSAVQIIDVNKINWTAVQIEINLQYVSTWD SYLPVCKPRFSSCIGEKTWLVNVDLERCETVRPKVKHLGIRVENTTSGTRVVVIVEGVCC KVNDQWSFVIKFKDMLARVRHRNAVKVDYSKCTWPRVWAEIDPVMSTLGLLMDRFVGEAE RRSRCKAEHIYYYGLQKAQELAFDSLGNARLNVLPNTFDVDVSNGTEYLMYVLCGIVSLL FLVVLIRLGIRLWRRRSMQKLRSRLEIWSVESSEDVHE 398
32 Protein UL145 G8XT31 MTTRRRLLPHNTTDLLCKRPRDGPGRWERLIDHVSLIQDSSLSATLVAGSDNCFILLERE GAFAAFHKGLIPEKTRAKLKGSEWIPGAWIVAETFPDDRVYICTFPETSSCSTSSEIHRE 120
33 Membrane protein A25 G8XT30 MTCFTTCLLFSFIIFTLTAGSTSNNISRLCAYNNNVKSRYLQTGQNVSISCLFPDTENFI FTFALRLYKDPEFGIRLYRILYYKYSNETGFVMRKTTFAAKGIEVFKTTRSNYTTITLQF KMNDNLTGLYTCYYENPPDEFIQVETMISDYYIASSNDIRYAIFTWKKYSYSNKGPLACY PYGRPDQICKNSTSTIMAASCGFLSINKNRVCGDALGNTWIPPIEDRSGQVPECLETYIM KRLNPVKKLPVLPLLPSQNATSNSIQQRIAFIHIWVWIDTGTLLLIWVLLTVLQWQLLRK DPSCCVYPLKSTRYFLLPKTFKR 323
34 Chemokine vCXCL15 G8XT29 MRVSIPYFKLLCLWNVLMIVTTSAHKNANRCVCGTSNLIKNVTHIKTQIKYIQPINANYH CKNRQVITTLLNNTKVCIDPEAVYIKRLLFMLMLKVNIQKKMVLDVYKTKVDFPGWGIQE IYKNLMLAKRRRRPLRRKVLDLNTARLPRRKPRSHDVTII 160
35 Chemokine vCXCL14 G8XT28 MNNISFTRLITISCVIFTVSFTSATIQELRCRCTGNLMTKIPLKSQYIIRHLPTAGCPKV EAIAVMDNHHKVCLNYHILEPQLFKMRHKLTKDGDTIFIKRRHP 104
36 Membrane protein A23 G8XT27 MISISKTALGVFVCLIITCFISEANQTTSASSGSTNTTLSPTSLQINSTSTTLSASTPDT SYSSSVVSTTAVTTPSITTVIPTTNSTSNTDISTTSQQTNATTVVTTAIQTSSITKSNSS TTVITTTNASTIASPTTTSVSTSSSNTSTPTNSPNTTNTSTTTNSPNTTNTSTTTNSPNT TNTSTTINSPNTTNTSATTNSPNTTNTSTPTNPSSTTNTSTATNSPNTTNVMSTSILIST SSLSNVTTKLSTTASQNTTIPETTISTSTSTNSLISSSFTSQTVLSNSTPTSPLSSTSHQ KSSNSSTEISTKNTQAINSSANTFKVTTLTTSVTTFTTDFKNHSNPNIKAARRNKASGYF IGLLLAILIVLVVIYIYRYQIKTLFCPKKRRRRYLTEVLGEPTELLIEMKEL 412
37 Membrane protein A22 G8XT26 MLKANILNIVSFNLLCYVTIISAECQFQHYYLDDLGGNADFSLTVLTEEILFEVGWLRCN AVSMENCTVKERFVSEDARGLSLRNISETTCPAVKTRLKSTEIKSRLGSEKATLSLYVNP DASLPHQKNIRSHLHLHFPASPTTIGFNTLYGIIQNTDFKDDQVPFKTIYKSFPVFLSTF GEGTCRVNGFLGNVTTANITLSKRLKIRLQLNTTAYGNHQVEWTALKHRQNKTYYQRDVR IDLLARNSGNHIVLDITVTHPIETPTVAVLTYKLFKKNVEAANLMIRCRAKCKSRTCSPN IKSRDYTWPFLWTVFASICEWICLLLCIFFIIIVSRTQFF 340
38 Envelope protein UL131A G8XT23 MNSCRFLLICMCVQIVYVSCNVSTAIGYWDKSAPIINYTQRENYLHRIFNIASQYFGTED PRIIQKINITEVILLTNAFGLEPYNKTYQLNSTAKVNVTGSSIITPAKKILSAIFEIQWD 120
39 Envelope glycoprotein UL130 G8XT22 MKTTIGLMFWIHLVHGYFKGCPIHPLPLMHANLFVSYTNYTAINCTQKLFALHTLNNKTL IVNDSKWTRQVIAYIDGKDLLMFRLLRNISACNNMTLSLSQDEKTLAKRIFPHPVSKQIP LGYRVRDGSRWTNCIFHIQTVVLMKSENNIQFQFKIELRHAYSTQGVVSTMCTHPYFSTI KRTK 184
40 Envelope protein UL128 G8XT21 MSRLRRRYFFIFTVFATACYAITYKETCCTHIALREQLEDCYDFKKCDLYTISFLCRVGR LCMSPRNFSKMNNLILSIKQNITKFALHRHVPYCNYNPAHVMNVGELRCALYTDFDDTPG RMIGLVDRLETTWMTPSYHVKILDLDTYLIMLNNTYNSTSKTMDTKMACNKTWLN 175
41 Protein S6 G8XSS5 MPRSGQEPTTTSRPNQRGDAKTRKTTERRHGTATASRPAAATHTAAGPAAVAVSKVPASN NTATPTTSTVPTVSSTTPQNSGVRRGGIRPRTRQPAPTPTPTQTPDGPPKRVTRAPRVAR VTPQPPANQHETPTLSGKDPKKTPNRPKAKTEQVENKETKPDKSKSRKVKDGNTTPTVPT VAIPAMEPTCTLLYFSVQLPQPKH 204
42 Membrane protein S1 G8XSR9 MATWGGGDGTYCLLPGLLLLFRVGPGGPVSQTSSTPLIVNGVLGESVTLPLEFPAGEKIK SITWHYNGTSIAFIAPSEAKSPQIHLTNPKLGKRLNFTQSYSLQLSNLEMEDTGSYSALM SSETTVNVSSYTLRIFRKLKNIQVSNHSQLSQNRICEIHLTCSVEDPNDNISFKWEALGK TLLREPNLTTSWDPRNSSEQNYTCIAENAVSNLSFTVSAQKLCEVAYMSTEARMLVAALM TCLVIICLLGLFLVWKRRRAGSLLCIQLCFSHLFSREHQAETLIF 285
43 Membrane protein UL124 G8XT20 MYGSLMIISHAINVMGNTNHSAVNTTSVTLTFSESTTSEDSGRTYSSTHRWMRPLSTLGA LLGMFGLVFVVLMCSFCSTDKNLEDVVQEIVETTDRQTRDTAVIVMPECETKKQMKIFVC TDSSCK 126
44 Regulatory protein IE1 G8XT19 MAANPPPKRPHDDDDPGEGTSSGPSPPKQPKIFQPEDPVTIARRFIQKTLNEEVKTQLSL GDPLFPVADNTDDDPFKECLEQLKLQLHISRQELGEQNISRYNESKRVIIKNADDIWDAL KKGMKLVNETVEQLSAEPDNLTRMCYLLKDRYVITPGMQEIWESFLAQTCNVAGLHMERC IKAAKIKVQQLVEGPEDKCKFVFLKHIEMMMKTLCMPRITETQSQAVSLLTNSEYLPKDL VTENAKILIETLKSEQETIFPQLDAVAVKVTDETAKNVNDESKVILDSLLMKAYDIITQS QEMLKTLCLYILEETVKVINAKQNNFNLDQELIDMETKLRRISNSCLAAITCGVIHHRRR PDVDTYRVIAGDVETPVRMETVVVHGAGESDDEEEVKREEELKSETPESPEEKTLEEKKE PEDEGKPRNIHPMVTRSKQC 440
45 Regulatory protein IE2 G8XT18 MAANPPPKRPHDDDDPGEGTSSGPSPPKQPKIFQPEDPVTIARRFIQKTLNEEVKTQLSL GDPLFPVADNTDDDPFKECLGGIDILAEAASMAGILDSSSTNTPGIIKSSSSIINPIHST PSPDAPYTPSPPFPEDQSPRKRPRKSTPMKMPPEWLPMKVEYNPQPITTPTSSCIVISDS DEEHEDSGDVNAPVCTESVECHSESLVVGKPQSPCTSSSSSSSSSESDSDTSESKNSPTA PPATKKKRPGKKQQPSFEPAKVRSILKTRMAFDKPTGPAKRGRVKMSDISRMFRATTRSL EYKNLPFKPTPMNEVLESAIAKCKTMNTTRAMFMIHYTRTYNVKSAIEDVRAQLGMICNL SISSPFTLEHTAPMVHSPSTVRNVSKACEDGVKGVWDLKEDHTHQLCPRSSDYRTIMVHA ATPADYLQAIKVCLPLLHKYPRQVCIRTADLNKGENMLPIYDDCSSAYVVGQFQTGNDDM DTLNQAVQKAIEDLE 495
46 Membrane protein UL121 G8XT17 MRLLVFFVTASWFSGVWGTVMHICQLPNGDVRVTCKSDVKPHVASVYWNIDQDHFPLSLH QTEFVTKQVTIYLHSQNSEYQSRLETLPPKHNITFNVRLTEHHHFRNESLCIARPQNFRA APICQLDLNILNLYLTGIIFTLSIVAIGMLKGFYGRSYKEAAA 163
47 Membrane glycoprotein UL119 G8XT15 MRSCILLLCILPLSLAHSNFSVSCHQHHDYEKHVMNSTCKVNYNHSLDAPDLMAIECFKK NVSTHDGRRMVGRVDVKGGNATDPDVQIFYNNTEQALHLNSHAHHTTMYECDFIAVNRNI TSKWIFHGSPVLSTYIKGTQENYTFHVLMIPDVNFTVTLLVGDQTMQPCFCGDSNRTEGK EFCFLFNHTVKHVTLKATSSNFNYTVTYTLVWAEDDAAYVALIYTVTLLFTLMLTLLSYV IYRCLYYLPLIKYHRLLSEEKPDPCVKKVGIKV 273
48 Membrane protein A21 G8XT16 MKTVMCGMLMVAGFAYQTCKPDEYTTSVGSCCPVCQSGYMATSECSEYTGTVCTPCRVCN GSGMTTIQNCSVTQNAICMCMDGYNCSKEVNNSCVECLRSLETSGSDINHDQNNDMSFSS LEIQYFAIPLILLMSLMILIIAVIFRYRNVLRLMILTYLDRSRFHP 166
49 Protein UL117 G8XT14 MFSKLEIVRVNEPIQLSLTPANKRKRHRTMVISPKNGFVKIPPDDKNVSMVKIIATPATP VQKSPPRPRNDTSNYPYGTSLIRRRRLPQPHPMVSKYGHVFEELGKLLQTHDSTHVQIQV NASCGNSFQYLKSAIVKLHNLTILAGMQIASQCLPHDSQTISNFKRHEDRGDLLRNVTDV VPRSACYADSGLHQLYISGATKKDLMDAMTLCLSVIDQYPNIFNVNIIKLSYPSLASFHL STYSEFTNTSAV 252
50 Protein UL116 G8XT13 MRSFILLLCVAHGAFASTATATTHISANTTSTSSVSEIRSSNTGTNSSSTHASTPMTTTT ASSTGKTSSNMTTLSAPMTSTSSTITTTTSTPTTTSNSTTVTSTTVSATTESISVSTNTT GSSGTTNVTVNSTRVPTNTTMSTTVLTNTTENTIESFSTVSPPDDCLRVSENLYYTSEDE IGSGDEETQRNTHPLYIATECTRNLTDNISCVFTPRNFSWQSVDSVTFSPTSCEDGVAVF HVDNTTFSTNPYASSFFMTTLYKLLHLDEVTLDINAHLNRYRQYPVNNRPIS 292
51 Envelope glycoprotein L, gL G8XT12 MLFLFSVLLTLASADNETCVTLVRQCVAGDSVLNGTQNGTSEPLVKPPSDDAMLSQLIRY NHSGITTITSKIPIDDTFIDHLALLHNNTKQLRILLAILRSDTAPAWMKAMSGYGVCGQE AAIYTCYADVCRAYDLTKLTYVNTIFTENVLGFELLPHFKFAVLLGARNEDSKMGRPIRI PIPKTGIGLFYAIWNVIKGFFTQNELQSPLIARLEKYYQDLDAEYKLLPKKNVLFFRSHG TQAVDAQTYTGQPAVIVKS 259
52 Uracil-DNA glycosylase, UDG, EC 3.2.2.27 (UNG) G8XT11 MALKQWMLKHIPDNQPSSLSPDEQSRLFGIHPSWITFLDLFEHETALLKSVVDTVRLARQ TETIYPAPEHVHRWSHLNEPQSVRVIIVGQDPYHDGSASGVAFGTFPGRQTPASLINVFR ELSRTIMNFQPPNHGCLDAWCRQGVLLLNTVFTVVRNKPGSHRHLGWQQLSERIIRQLSE TREHLVFMLWGAEAQTREYLIDKTKHLVLKSCHPSPRNTQKSFVGNDHFTLTNNYLQEHG QHTIDWNL 248
53 Protein UL112 G8XT10 MEADQATSIRKYITFNSPNRILHQNVSQVMDVRQFIFESAKIVDCVNGEGHVSTLGKGWL CATMVQTGESSSSSKSQQGFMSIDITEDNVLRDSLFLRGGVVFNKSVSSVVGSGEAGPAL LTMISESGSLQLTYVRHFTNRPATLPVEQHVERRSVEEERRKKPSSSSTVDANGFALRDP RLLNRSKERKRESEGGSPRGDKRQKTHHESRNESEARPPPEPGTDAVAFLNYTNAALADA VDGALSSSMNVDVPGDSGETRSSIVENRATEDMGDSGLGEAAETRNSDDGGVEGSSNPVP PPNSQDLVPHSPRFDDIIKSLKKLFSDCKDKRLCPTVARLPLDFKPSDSDDEVPGTSSAT APTPPPSRPSRPVCEIKPSVRPVEERIERSDRRGRGRSTRSGNNRTRQPRRPRRRDREPD LTWRPPSFLEDGLEIVDEDEAAIAAAAIEGLM 452
54 Interleukin-10 G8XT09 MSALRSYCLLWCLVVISSSKIRKKVDCSFRTGPFSGMLQSLRHDYSKVKTVLHDHDTVHT TSLLTGDLLDEMLGPRGCQTTVQLMEKYLSEWLPKADRLYLYDNQTIRTLDRLGGTLNGL MKDMVQCPMLICGAPSSAMMGLQSRENKLPGNAGVYKGLAEIDLLGNYLELYMSKFRR 178
55 DNA replication helicase, EC 3.6.4.- G8XT08 MSITGDDEVEFRSRKYEDSLILNLSSAAKIERIVDKVKSLAGECFEKEDFPSQWYRFISQ SVRQEAIGEDGEEEIRVPCVDKIPFFPFRVLLITGTAGAGKTSSIQVLAANLDCVITGTT VIAAQNLSSVLNRTRSAQIKTIYRTFGFNSKHVHLSDSVGAWSQRYRVCDPSDEDTIQKL QLNDLVMYWPVIADIVDRHLNMLDKKASLDGVSELCDSNIIVIDECGVLLRHMLQTVVFF YYFYNAIADTRLYRERRIPCLVCVGSPTQTEALESCYDYQRQNKNVRRGVDVLSALICNE VLMRYCDIASNWIMFINNKRCTDLDFSDLLKYMEFGIPLKEEHISYADRFVQPPNLIRNP SYASDMTRLFLSHAEVQAYFKRLHDQIRVSERHRLFDLPVYCVVNNRNYEELCELTDPLS VPPRIDVWFRNNLARIINYSQFVDHNLSNEITTEVLRGSTARTGEGEEEDEGDTGGSEEQ IETLLTLRITYIKGSSIGVNSKVKACVVGYHGTFESFVEILRKDTFIERTPCEQAGHAYS LISGLLFSAMYLFYTSSFATEEILREISRIELPDISSLCGGVEEVSTMPENVVEDVYDIP CLSSEDGYHDEVSDTDLLTNTDLYTDPFFLKYTKPPVTGLLSFEETVHIYTTFRQIFIRR YQVMQRQTGGEFAKSTMIAYNRRNVVTKGNCQIVSQTGSFVGMLSNVSPAQTYTLEGYTN DNVLSLPGERYRLHPTVVTRGLSRLVVKDVLGFIYILDVNVSRFVESAHGKSLHICTTVD YGITSRTAMTIAKSQGLSLEKVAIDFGDRPNNLKMSHIYVAMSRVTDPEHLIMNVNPMRL SYERNALITPYICRALKDQKTMLIF 865
56 Portal protein G8XT07 MNLYHWDGKSSFSKHSPANDLTLSTIRSILAADERLRIKESSYFRDRNSTSSSPVIDIFP TPKTLSYIKFLHGFVGACRGKSIHQILRDPCVLRKQLLYGICKTIFNTVTVKHIADEWKH HAQLFPYHAVNPEDFDQYLELWASSVGQSVRTGILGAVRDILYRYADDDNYGLYIDWLVT VGIVPIATVKQNPRDEQLQEQFVRAAIQKATESHPLARELLQHNLPLLLRIIHNLNAVSI SNSSDIYIYKRGDPGKIEAKDRNRPLEIQIVAEPLSYERDRLIYTTPVAHLYEEIIRYDS LCRHQKVCQLLNTFPVKAITASQHEMNCKKIIDMMEKHDRAGDAKKAIIKFLLNVSDSKS RIGIEDSVESFLQDLTPSLVDQTRLLPPRATGAAPSGNVNVPADRDIRDLFKKQMIKCLE EQIQSQIDEIQDLKTINQSWEQHVRELKSLLSRQEHQHRTQTAMMPDAELNHLSIIEAVK KAQEVSFCPFSVDDNRTVANSFFSQFVPHTEQLEALLSDLWQNEYFRTFRLRRTVTAQGD EDAILYSNYTVERVVVPYLFNILSLSTLEPIPEAYLDLSFNEILAAAYDESKLIQYVRFV CNREKARWEHVEKQWRKPTSTFTETITKHPTTRFGNGRPDDSRRDGSPLRRPRDSLLYAT RDHRYHTP 668
57 Cytoplasmic envelopment protein 1 G8XT06 MDALMIRGVMEVHCEDRETVYCMQPEIIDITHRDHRLWVHTDHGTLISMHEYYEECQCRG SWLGYSAIFLLDTEDTLSRVKLSAIRIKHRCAVIRPSNLKQFTLCIVLSCVENLALTKRC LQDLRLFIREISVNDPLDVLLLNSCRRLICTALYLFFDHPEEELKAHVPRIFVLYLETRT SYVETIARLFLRLASLKEDENASLCLMNRTTNDDMLVSTALHEVLNESYPNFYKHFVNGL HPHNITP 247
58 DNA helicase/primase complex-associated protein, HEPA (Primase-associated factor) G8XT05 METDSSCLLGVSCHLGVYGVVGCVPVLRCLFLELGTSEPQLRSLLLRGERLSDSEARVLG RFTYASLAVGATEAEERRVALNRRSALLAKTFNSSSAARMLSRLFTVVRVQLDGQRVEVL AVEAAFSSENRRRLEEVLSLYHVAKLVVIGSYPSEPYGPGSSLKKDPGEDSRETLVEYGT HANKKFKRGYCASDLALSFRVGARKYVWEQSDCESVRLEDLFQVSDVRFLRTDMRLVTPR NFVAVAVTDEQCFVLLKTAWRWIYDLCFSGFHGMRPLFDYLGPDLYDQGGPRSMFFPGFP GLSVYAVEGLSVLLKETAIDAMGEIVSCCGLPDIVGTVGKFSVCLRSDVPVLVPPEDLSV FSGENKPLRINGTSFSVRSRDDFQCYLHLKPAPLHRFTLQGLIEGVLARCVRVEDLDTDF PYNHRITRDEVCCRFLENLRHQALDAFLHIQSLLGYLLQHLTSACTSAGLEWVMVKHHRE VYAYDNLAAHCAMVSAEVCVRTVLSCYWRKLFGDLAVDEFRCVHTDSAPGILVLLEEQQQ RVVGAFHRSGEMTWLDVVGQVLTRVLDLTVSSDASHVRDLYREVLFRFVSYRNDVSFWVS TYYPGDVVRAHVGVIDCAPFPGVLSLQGEVLVQSRDAALETDIGYGRYLKQAFSILGFCV NLQLERQAQISGGSALLTEDMVEEIGSTVLTDGLHFFQLNN 701
59 Envelope glycoprotein M, gM G8XT04 MGSHVDNINSRTWSISVLCLLLTFVNVTIHLIAMNFPDIGYPCVYNHIIDFTQLNLTSYN VMHVFNPQLYMDNIQITVYVIFTQFIFLIVTLYYLICWFKICLRKEPGLNLNQGSRDISY MGDSVSCFLFVLCMDTFQLFTLTMSFRLPSMIAFMAFIHYICLTTYTITLITHYQSLKRN KFLLSRIHPELRGTVQLKTVVVNLVQTNLGFNTMVVSVSLCLAFGNNFFVTSGHMVMVVF ALFAVLSILCYLIIESILHKYMKVLFGYHFGTLCGLLGLVYPVLKYETLYASAYAREINV SLGILFVIWAIFTLCRFIRFFRRSSRSYKELTSIDEIAALKGEDDEA 347
60 Cytoplasmic envelopment protein 3 G8XT03 MGSQCSSGICSQFCPTTANPLTDVLGRRVDLGVYDVISSSEEEDDLKNDDGSDEERPPPK KPITAVVQLKPPRTKDKKTLLRPPTPKSKRKSLRLI 96
61 Alkaline nuclease, EC 3.1.-.- G8XT02 MDVDDLACVVTILDDEPLNLFLMNSFLLHQDGLRNIPFNVLRLVYFYHIFVKVRRLHAIS IADDFVSRMSSLVKDDWLREILSNRYRESRDELIGALDSLVSNDYENTAYVWLSRLLSLV PDYKQIELYQILEKESRGQAESVVWHAIRTDTVSATRFYEAFVNGNAFIPVEARKPWSSP AMTFGFHHEGVVKTLIEFHIMCGREPVRDGLGLLIDPTSGLFGASLDLCFGVSKHPETGT LAIHPGARVYEIKCRYKYLRKKEDPFVQNVLKRHDLQAVVQFIVSHPIPGVEYRPDCETP SAKEYLLSYDAIFRHTLKRHRPVKAPEALRSHVDDLLYLNKNQTSEVVIFDAKIVSDETF SENGKKDTFSSTSVDAGWGSENDENTPELVNRLDVFEISRFSLPAFVNPRHHYYFQTLIQ QYVLSQYYIKKHPDPERIDCRDLPTVFLVSAIFRERDSEELGRELCVGGRVFHCDHVPLF IIVTPVVLDPRFTRHAVSTVLDNWNRSLSRQTNLPIWVPNAAQEYVVSSVPRPPTP 536
62 Tegument serine/threonine protein kinase, EC 2.7.11.1 G8XT01 MSSEEIPTSPDSAESSPTSCPPAPKKTRRRRRICRRGCSSVKRTLKYPKLSESMTGSDVN EMTSHSTASSGSGSPTERFLRCEERIEKSGRSSSENMSCPICRRSEELPLTSSVVYSGSE DEAVEREECGHTYSNEHRIVTSVRGLTCDPNVFCQLTAPQLYETTGASTHVVVYAPKSLD FCESVCQAVNLDDENRRLGQGSFGEIWPLDQDRVVKIAKRHSETILTVWISGMIRSRAGG VSDQGDGVFRGLLTSVGCCLLHNVTVSARFQTDMYHHDAWGLESLNSYGMAFKVLADAVR FLNHDCHVCHFDITPMNVLIDVNPQKPSEIVRVALCDYSLCEPYPALNRRCAVIFQETQS ARILPSCRHRLRECYHPAFRPIPLQKLVTLNAHARFPIGSSQRFCAAEMTALTNVLMFCL ARILDRRGFETVRAESEFLLFKHASAACRALDLGDVVECSKACLLILAAQASYLNYILGD VAVPAVCRLHRFVESRFDRRQVAVFKRYYGECGKVMDHGNVRKNLDQMLNTRCGLYLYDA VRRAGRFTSVEDLECDCRIIFPE 563
63 Tegument protein UL14 G8XT00 MTSTNKELLKEAMRTQLEKTHHQFLKRAYGEKHHLTHHQVLRVMRAALQQEQRRDALAVQ EISACLLRDQPRVQQELGKAKELQRLQVDERLDSLTELKDTVEDSYSALVDSVSTVCEID LEEERC 126
64 Cytoplasmic envelopment protein 2 G8XSZ8 MASTSVCCTRDLRLLKYFLQRECVWRRVGASSKHREYVAIASKSATFDMDGQDSRCLLCR IIVLSKDGVNVVCLSINTTYMGSYSTKLHRVKHDVGGVETFYSFKIDDELCPKTVPFAPT FTPVRSTVSFNGMSAEFFYDVCSLPSAEELKSIMVKGGEQSNKKAIRLGGPGAWAVKTSL GVDLYFYLLEYDLYTTCTGKDFLPSLARIVSATTCCGEMSCPFCKDHGTHVDCTGKYVGP VPDKGMCFCYMLCKMPTAPITNDRYMPFLCDSEEATHISVSGAGKSKVTLEDPLESYITV YNSAGKALPLKSGCWKLVKLSHPASPLLLCACPVLKGVVL 340
65 DNA packaging tegument protein UL17 G8XSZ7 METHLFSDLDFQYRFDSLAQVPIHLVFDETVLTLEKLSQLVGVYFKTEWGQDWQRALFTV VPRRWCLRQYLDQRGLKSPDVKIVCQHAVFTTIGVSCVDRVILGGRLVYVRFVLNHRQSS VAAENRRSFVDCEFFVRDLLKGRHFRSQEEASSDRLVLPVNDRPFFEIPHGDARSKIVGQ QLLLRSGVTEQYTGGALEPPSKIRGYELSKRPEVENPDILYAFGENEGRIIPWTEEWESG GVVGIQTVWDVSAQVRVHVLWYQRSFWNSLKIDYRDEEVDIRQSLETYRRHLVVGSSVFE NIYRELRVNVAERRAVRQLFDCFVSADLDPSFLWEMACASLDLWIYRVEKESCIIKALTT CLQQSRDVQGFRQYRVVGQGGRREAWADVIYNASGRVDLGLQVSLEVCSSSGLWRTKDRH GYVLDWVANPEVCVIYATSHLDIYWILPGGFGTVLPIPVHGVDLGLLYERFKTPEVLFTT 480
66 Protein UL92 G8XSZ6 MVMADMVRPLECSPCEALGGCEMHQVCNALTEEIQLRCFYVCVNCYKTHVCDLSEGCALV STLEGSVCLKTGLVYESLCPATRVNVLEPTGETSVDDVNVVGVIMASVYNYLMAHATRYA DVIKEVVDDGRLKKQVEDAVYFTFNRVFRSVQNVQRISLPVISQLFTQLIIGIHAKNTKY DSSVIKVSRRKREDALLKQMRFEYGNAPVFGS 212
67 Tripartite terminase subunit 3, EC 3.1.-.- (Terminase large subunit) G8XSZ4 MLRGESLTQIQRRYEELKKKKKSPASYISTCFPNVAALYRKRFQMMHPELGLAHACNETF LPLVTFCGRYRDYNSPEDEKRPHLLFSETLKNAIDQVTFWPCPDHQRDAYQKIDALTELY RDPQFTQINNFMIDFKKWLDGGFTPADQEHTRIHLEPFQKNLLIHVIFFIAVTKLPVLAN RVLQYLIHAFEIDFLTQPSIDIFKQKATVFLVPRRHGKTWFIIPVISFLLKHIIGISIGY VAHQKHVSQFVLKEVEFRCRYTFATEYAVENKDNVISIDHQTAKSTALFASCYNTNSIRG QNFNLLLVDEAHFIKKEAFNTILGFLAQNTTKIIFISSTNTTSDATCFLTRLNNAPFDML NVVSYVCEEHLHCFNEKGDATACPCYRLHKPTFISLNSQVRRTANMFMPGSFMDEIIGGT NKIVENSALITDQSREEFDIFRYSTMNKNAYNHFGTKLYVYLDPAFTTNRHASGTGIAAI GTYRNQYLIYGLEHFFLKDLSESSEVAIAECAAHMLISVISLHPFLEEIRIAIEGNSNQA AAVRIACLIKQNILCNHRIPVLFYHTPDQNNIEQPFYLMGRDKRLAVEEFITKFNSGYVK ASQELVSYTIKLSYDPIEYLLEQIRNIHRVTLTELNSTYSAKKNRQADDLIIALIMSIYM CDEIRSYRFKPI 672
68 Protein UL95 G8XSZ9 MSSEAGSSGAVSTALCSVERLVELSARSDPVLGVSEVLKFDEAVEMALVACEAASPHDRY RLIETPSENFLLVTNVIPKEMATCSGESEAGEKKAVNQDLLGCLYGEAFSPPVVSSRDYV LKNLRHTANYHGELLYGSYLMYNKEHIGLSLSINKASHVESILRDVFAPGLLEHHNVCDI EALLWLLYSGPRSFCARDACFGREQLGYHMPFPALLPTLFYEPVVDYVTYMNLAELYVYV WYRGYEFASTRDDFRVSLNSVTLDRLQEVLKAVRARFSDREVPCWPVSSRTCVFCALYSQ NRLCLDVARNGIGAVFYSPILLQDCPAVVTDVTLSHILPGQGAVTLFPVYHIGKLLDAVR YAENGVARLEL 371
69 Tegument protein UL88 G8XSZ3 MEGWLDAALVLPKSGLVLDHMLENEGVSDFVRRMLPAPEDVKENCVFASELAFIASGRHG RRTSMFSIYWHLHSELIYALTGITYCVKIVIECGQIQYRDARDAYAIPGIYMIRPSLSDS GAISSRNVSWPSAGIRWPGDVRIWLVQRKVETFEKFQELLNRLSESRIEKWCPMDLGEKI DPTLESLSLGGTEFACRVSVAYDHLRAGDLPRTAQQLLDHCVTLAAAKIMLWLDVPRLDN FFLCQVCLYELGEDEVGEELIGLLHTKNKVSNPDFNLHRRAMKSVACLAFLLNCLLRHQN MIPELEERLNENDLYVIATRRYYRSSGGVERRTIAAGSRLLSEYADTLSVSDSWRRLNLP VPLDASFTREQLVGLLRT 378
70 Protein UL87 G8XSZ2 MASSDSICSREGESALIVESFRQRYVLNVPVHVNSYNLTQELSMEEDARFARSVRVDVER VRAVFRTLCEACPLHVTTERDRVRIVLCRLLLGPVAVPCYCDEWDTNEYMVEYTHFCSGP LLYVHRRCRCRTPAGQGLAFSVMRGHQTTHLFRGLLSLAEWNQHLPRMFCACMTFTSDRY VMACLPSALSLHLDDYPYLMGEIGHFLTITEIDECVQAMVRHLGQQVSNRVQIHYKLLFG VHLRPQAPLARSGTEHFFALELQKLWLNVEYHNGVTFDFFGCIFRQFYIRRAQTMLALRT PEQTACVLSAFSLSRFKQQVLYFKISVNYGKHKLGSGRNLLRYRRLHILFSDADAVWRNL FFIYYEQANADQVESVATGKEAAGSSAASSVRAETSSSGTSRLLRQTVTATDLCRRRYIR IVTRLLFARYRRRCETVMSHETPQAILDFTGSFWSVSYLAQVQETRRATQRYAMQLRKLI GGREFSEVTSVTLDRIAVNAFNTNRVINMKATLSARPRSRGHFPRNMTHSFVMYKHTFKE PACTVSTFVSNDAVYTNSLNVNIRGSYLEFLYALGVYRLYVNIDHFFLPAAVCNSNSSLD VHGLEDQAVIRSERSKVYWTTNFPCMISNTDNVNVGWFKAATAIVPRVFGADLEGIMLKE LTCLRGMSDMCIDYGLHRVFTELEYRNSYQIPFLSKQLILFIRGCLLKLHGGDKRLYLDR FMFEVVKSGVFDYSKNITGHTKIKHTCALIGSRLANNIPKILIRNKKIKLDYLGRNANVL TVCRHVEPGRTSVGRLKVLLEVLRALYAVSNAPHTKNVIRQTVARLGGRLEHVGE 835
71 Major capsid protein, MCP G8XSZ1 MENWSALELLPKLGLSNDFLMHVKTSAGEEMFDSLRMYYGDDPDRYNINFEAIFGTFCNR IEWVQFLSTSLALAAHAIRFDDLNKMTTGKMLFHIQVPRVASGAGMPTSRQTTIMVTKYS EKAPITIPFELSAACLTHLKETFEETILDQVLNIEAIHTVLKALKNTADAMERGLIHNFL QTLLRKAPPYFIVQTLVENATLCRQTVNRVQRANIIRSFKNKLVTSTFVLNRTRDRDFIT RFLLRMVEAATESILDNPQTYVTSSGKRLSGVLISTANVMQNLTSMLNQLITKENVTAPA TYGNFVLNRDNAVTAIAHHAIMADFNQYTAHLATDKQDELTETALGRSATQQMTQLQMDV IKLGEHNVALENCRRVYKNTDTRDPLETHINLTFFFPMGLYVSDDRSYTTVESKLKLSDT MQNTLPTAVYFLNRDRHIQKIEYADTLKTICHPVFFDPAPCLQAFIENGPPADRSLCQCQ FQHEHMGSIARRAIHFYRVRREVCRTTNEIKQDHSNEEFFKTSNPSLYTELHPFFDFTHH MENGDVAALCTPRIMVGNLPQGTAPSGFHDSRARQAMEIMKTRPPPDYEGTLQLLTVTLT NPNYPELFYLLDLLIHGNLDAFLILRNLIARCIVTTFNTRHLLAFAHSFPIIKLIAEHLA DGLIPTQIHTHYQNILAIVRFVARVTSLSSPNVKLADEPLHTYVSALHDPRLFPPFLTHL PQTRDHIRIIADRQPLANANIEIRHHGVSDVPRLAAMDADEPLFIDEDRISDEDCVLHKV YYFCIIPALTNNRACGLGLNLKILLVDLFYRDAFFPPASREEREDLAAHPGEMLIQLVRD VATNHNVGILETCREMFLALQFVPENAKVLEVQTQLDPAQNHGNMTFTSYQHVLYNGFCA TTAPKILAEYTIAIPFHRFYSYPGIAMAVSDDIKNFIGDFPHYHRNDGGFPLPTAFAHEY HNWHRSPFSIYSASCPPNLQSIMTLGTMHHKLSPVSFILQSKVRLHPGFALTGVRTDTFQ GDTLLYSGKSSTSLIINNPIVTKEERDICTTYHVTQHVNNIDMGLGYTCNTCLAWLHQVR SDMGATVQDLFQVYPMHVHRDPEVDQWIRQTIGAERIQMLDTDTMAALTFGKIPTKQDVC NLHGQRATCELLLTPVTTPVNYFKNPNTPRGRTSCTLGVDPYDETAAQHTLYNHQEPDAQ TFAATNNPWSSLPGSINDILYNQRHRERLGFNSRIYSPCTQFFNTEDIINANKTLFKTID EYMVRAKDCLHGDTDIQYVCMEGTDELIENPCRFLQEAYPLLTTTTQGLLENRMKNPNSY NEAAETHFGNYAIGEIIPLQLQIMYNS 1,347
72 Triplex capsid protein 2 G8XSZ0 MDVTVFCTFEHKLTITDISKLGRLVGAVIPIPHRHHLIKHQNLGLHQFLDKNRGYTRIRS LLRNMTPTVLRRVEGNQLTLNVMKHGQCYTVLNTGPVLWEKGDTLCCIPPFNGNITAQNT TSSSPLTIKIHDWELVTPWIVPASLAAEINQRLLVTALFSLDRSYDEVKAATQHLRTITF RNTTFLIPDPVVDGHLLLDIKNACISMSMVANLASELLNTYIRKLALEDSSMLLVKCQEL LMRLERDRPESRLHHIAPEDEVSRLSALFVMLRQLSDLINEQPMFTVCDVSSDNKSATCI FKG 303
73 Protein UL84 G8XSY9 MSHPEKQLGKDPPLSRLSTIMHSTENILTLNEKWSLSQTMTEGTYKLIQLNLDLRPDDLH KDFNILLSEAIHIEPVLQQPQEAMICAVANADSDLKAAFSIFPGHPGCKIIRSIIDRDID RLAIIRLSLNIFALRVVRPLMEQLPVKRPSEHYNPTTLHDCINLQEEQVTIRVENECHRI TIGIVDTILCWHVIEGGISGPRGLTSRIALHLPKLPTLPQPVFSRLLSSSCPLTLSSLSH SADNTLKFNVTATQGVEMNTPISFELQLFQDTVQQPYFSRTPSPYFTPNREEYLDVRLPY DLTVKQAYTLRLYRRFYGPFLGLFVPKPNLPVKMPVTIWLPKTWLEITIVGRNVSLQRDL VIGELYFIASDYITNRGCSSAFTHQVKSSLHLNNKHSCVSVLGTSIRLEDLLSLNIRPRE TIQSPDTKTTLAMILKNT 438
74 Tegument protein pp65 G8XSY8 METRLTRRRHQAGDLVNKIGPISGHVIKCIFNGTDTKLQARETRMLSTGVHVRVNVPAII FATHFTADSERDHDWRGLKSQHTAFYSTEIQNIQVAVTNTSDRVQSTNTDPFSIYVYALP LKVVTISGLHVYRPSSEKKTRSSIPEADVIVQRVASHWSVRMTVTQLIWTSNRNDDTEQR HSSCFILDPHGIPFEDFDSVTDLVCSDEAVILTKVQALTSEKKLRIYLECPKEEDQLPTR LFCHLLLENKNPDIIMNRNPKPFLRPYGTNGFVIMAPRNIIVKPGKTSHVCLDMTFRCLG IDYIGLIVPKSLPNLSISSNFLRSSQHLFLEIQTTGETAVEIPKGEDIAALHFFESHIFL HKNDQFYTFTGQYDVECKLEYDHVWDDIQDAIHTSAVSAVTGPEDSGDESDDPFKSATTG EKPRHDSDEDNSDEEDTGASKNAVLTWPCWKAGTYTCHLPPLIARAYGPNLKKHDFYWSE NPTYRIFFGLSGEWGPPISGKRRRPTAESSSLTVVPSTSKKRHRF 525
75 Tegument protein pp71 G8XSY7 MSTATVSTAARRTPRNFNTLEHFSCQALRLIVTNPCHLPANEGKSVNTHLMVRVPKACVL CCAQEISSVHDAIQLRDLNIKGLTISQPPSTEDSTDEISLELYNFTKKKASPGQPLSVCV FAIPLARVPITGLHIFKTRQDENVSTAVTRAQTRAHIKRATFFWNVKINLKDIIWTRRQS PRLPRGQVFLTNFYFNTGQIPLTLVDAVDLLATSDNSTYIQKTETVGRGPLMKIYLQNFS AHPPTELFLHISVYSHQGEVVTRHNPEPFLSRHPENGFIVRSPQNVTLADTQTVTLHIDN AFESNHRYDAVFFPKDYAGLSMEGGFFPDRTAIQIKVTNLTLSEYHIDYLQDLGTIHLFP RGFFFPLPGKDKTRLCHLRLRAGIVPRQTVVSGLVSEFKPQSDSEEEESDDSLPTPTVLK EAKYFAASESEEEEEDAGEGPSSITRTTMTPSAEAITVVIPSWNVFMAVTNLPPMTCSIS APGIKATSYLKSDYSDVRTAADIRGTCDTIPEPPQAPPVIRTAPTSRSTARI 532
76 Capsid scaffolding protein (Protease precursor, pPR) [Cleaved into: Assemblin, EC 3.4.21.97 (Protease) ; Assembly protein (Capsid assembly protein) ] G8XSY5 MAPVYVGGFLVRYQEAPEEDELVLPRHVVEEWMENEKVEGIPLNVNHDENAVVGTVLGFQ NVPAGLFCLACVDSPRFLEIVEKTAEKSEVVASGPRGELTPDPVLEFLSGSYSGLSLSSL RCSVNAAESVGPLSSDDGRYFKHVALCSVGRRRGTLAIYGRQVNWILSRFPDLDEETCQV IRDSVRTSSEKRSQEVEDRFHSDSYGLLANSVDALYIRERLSKLRYDKKLLGLEGQSTYI KAGEPTSVPAVCDIKEQDAEEEAESDHPASVMAHALPSAGPGSAVAPVASVPGAMSLAND GVYLPKDAFISLLNLNAGTHGVSGGAALDSSIPRRLAQSVPASYPPSFPYSSPLLPTGYD DVRYGPYHYGPMVGHRPYDMRQDYHLDRDRYGHMMELGYHPYYHAARGRFQGRKRKKGEV SSDEEDEMSFPGDSDYSKPRKRLRPEKEHSTCGFDCEQRHGRYEEIKDALSEIRRDLAAA RSAMQMSAAPMSTSLSPTSSATSSCQDQNLVTEKKSAEKAPVASTSAMPTVNASCGPLIP PKERPQNMLDLNRRLFVAALNKME 564
77 Protein UL79 G8XSY4 MEPSTETHVRTGRFSFTCTHNLIIQITTKLASGQPLTSFQLEELKIIKLSCLMLFHRGLE LLLLRETLNNLGISDNTVLSRKAPLDYWFHLAEELKHIFPELDLNRIFNEHEAAEISRHL TIKPMAADLLLTKFIQRHTQLLLKLPPDLARNGNILFSLGTLYGHRLFRLASFFNRYWGT DSHEPLIRIICQKMWYFYLIATGKMLITPNALEIQRTRHEYGIFNFIIDDYKTFTGTTQL YQEQPLSPSVISDTHQYLSVPEIQFE 266
78 Envelope protein UL78 G8XSY3 MFSLRTEMLLHGAMMGMFVAAAMLILLAVAMCFVAAKRRCVPYAVNIFAGNLLVSQLLTI VAMMFSQGFMYDPPFNPSYCRISMFFEDVGTYATSALFLFLIMDRMAALANGRAEWKHQT QQNVSTAIFASIFAWALSAVVSLPTFVTSDSAHRFPFSCETPLGYSAMTMSLHVWFALAA PLIVVVSYVLGACYEEERDNLWPYVARVWTFYTTCLLFFVPYYGIRIIRSFFGLPGMFPE VMDYVEVVCHMVFLFRVVILPLFVLNLSSPAPMVEMDHAFESMMKVGFCQETMLAVWKKF REVCRRNPSGDKLKLMDDFERGPVFVADLPSKS 333
79 Capsid vertex component 2 G8XSY2 MNRLETFYHLPVPKIALGPVPVAVPVSVVAAFEPHVDNVLWAPERVLRRLRDATGIELRQ RRDEAVIDRIKKRYLKEELRQFRDAVANQCLGLEGRLSEAEMLLRQQVTDLPVSSSPRSS PVRIEGEAAPSEGAVDLGKGQKTGAVTWAAFCHDDRHALHVGITQNDPTICFHRDFRGEL IGTMFENSSTWTFSFGVWYYRLKRSLYTQPRWKRVFRLMQMESFSISQELLVATVGALEN VTVYPAYDCALSDLEAAACLLAAYGHQVWEGRDAPDSVIGVLQNLPYILNRLSEEIHREM ANWKESVTTNFYSYQDSPDMRYYVPMSGGRRYASGTFGRHILVRIFTHRNVLQRLAGSEA QVSAVVQERISGQAVDESTLTMWTRKLLSHRLGREVPIFLHEQQYLRSGLTCIETLLLLW KIVNSESVFVSRKRRFSLTDIIGSDLGAPKATVDPGYTGSNVRNFEYLVEQYIIPWYQWD PTVTASQLFPGVVLLAITESVRSGWDPLQREDVKTMDGGAITVQATKINPIADFMFAQSS KQYSALKRLELHDTLLFHYENGVGKVLSVSLPRHRVFCLGSSLFNVNDIYECIYFFVLGF LPAVAVT 607
80 Nuclear protein UL24 G8XSY1 MSSSGQKCRSLCDLPKYRAVVGKRKHFLLYRQIVRSLKSFQRFNCTLGGVFPPELATCRR SVFFEVTLLRRIPDCIVLFNIGKLDRKIVCYVFEFKTTQSSADAVSVRKHCTHYLQYVQG LRQLKDTVEDLKEFAIGGVEGDIWEVIPVIAFYQQNEMSPSFCRTFRVTTLRFRSESVVR ALCRGQDESLRNVLSLTRAEDRARSRASSRARVRRRRLRAARGQRAVGTRARAAASAGRH RNRVKTKTG 249
81
82
83
84
85
86
87
88
89
90
91
92
93
94
95
96
97
98
99
100
101
102
103
104
105
106
107
108
109
110
111
112
113
114
115
116
117
118
119
120
121
122
123
124
125
126
127
128
129
130