Chershoee
id Protein Name UniProt ID Sequence Length
1 DNA polymerase, EC 2.7.7.7 G9M072 MFYNPYLGGGRRAAPPKRSSESTFLQIVPRGVMYDGQTGLIKRNTSRKPIMFFNENKYTL SEDMVWPSLSSDEPLIPIRGRVRFHTYDQVDSVLSLDTTEEVPSRYRRHIIPSGNVIRFF GVMENGRSICANVFGQHSYFYCEHPETDRLREVIHSVSELVPEPKTPCAITVLPVKKMSI YGYGTSCVPHLHRVSISNWIMARKIGQYLLEHGFKVYETRVDPLTRLVVDKKLTTFGWCF VDRYEVRARGRVSTCDFEIDCEISDLFCSSEDTSWPLYRCLSFDIECLSASGGFPTPENV DDIVIQISCVCYGTGREDAGVKFGKSGKHLFTIGSCGPIEDVDVYEFPSEYELLLGFFLF FQRYGACMVTGYNINAFDFKYLLTRLENVYKVGVSRFGKLSRDGKFFVQSSQGKSYVSTN QSKVTISGTVVIDMYPVCMAKTSAPNYKLNTMAELYLKQQKDDLSYKEIPVKFLANEAGR AVVGKYCVQDAALVKDLFNVINFHYEAGAVARLAKIAMRRVVSDGQQIRIYTSLLDECSC RDMVLPTYRNSEPGEEVSYQGATVFEPEIGYYNDPVLVFDFASLYPSIIMAHNLCYSTLI MDNGECPDEEKVYEVRFENGTTYRFVRPEVRSSVLSELLTRWVAQRKAVRAAMKDCTDPL KKTLLDKEQLALKVTCNSFYGFTGVANGMLPCLPVAASITRIGRSMLQETARFIHDNFSA PDFLKTFFNAEDYVEGGVEAKVIYGDTDSVFVCYRGMKPSALKASADRVARHVTSCLFTH PVKLEFEKVFISLMMICKKRYIGKIEGSVGLSMKGVDLVRKTSCEFVKNVIKDVLALLFD DAEVSSAAVSLRQCSMEVLKKQGPPTGFFKILERLTRARDELHTGRVCVDELVLSSVLSK DISLYKQPNLPHLSVIKRLAARSEELPSVGDRVFYVLTAAPVDVRRKMNNYELAEDPLFV KEHQVPIHADKYFDQVVKAITNVLSPVFPYDLDKKDKFLLALLPTRVYLDKSFLPYTVKD VAYV 1,024