Chershoee
id Protein Name UniProt ID Sequence Length
1 Protein UL30A U3KRG9 MACRDARWVRFIRLRTLWSVRPRAHVADLEDFAAFYRTLSDSEQQEFEQEAELASRSQRV RDLREARRQLKMDLMCHGG 79
2 Tegument protein UL24 F5H9N4 MEETRAGRYIVRAGSGGQTEDTASGAESVLATLAAVRTRRRSVVCDGPPGSPTDSARHMS DLASLALTAEFGLGCLEAYVRINAGQVLPVVWPPGWNLVLQEIETDEDFKPEDVKAWSHY LCCQTRLAFVGRFVNEGVLSPDQQKKTAVCLISDEGYVFCYVREDTAVYYLARNLMEFAR VGLRAVETLHCMRYLTSSLVKRYFRPLLRAWSLGLDTMARFIIRHHGQFMPLTYPPGTEL RLCNLRCFENSVEGGHLLRNIKTAFGMRVLGLGTVSLKGENAPFPHLRWPVDLIPIVVAY TGAVYACDVRDDRYIRVGDNLNTFMCLGLNLLFENRRFSGHNGIYDRVPDCPKGRQHR 358
3 Uncharacterized protein US33A F7V999 MSLRFPERAGYEKLGYRPHAKRVWVHDPLGLTRFIMRQLMMYPLVLPFTFPFYVPRS 57
4 Uncharacterized protein UL150A F7V998 MASCSPPRRVSPDLLVSSELRRRNIWRRVTCVTGERGSPAVTTAVSSTRVRPAVLCGKAP VSETVDEKENGAATAGGGGVNAAVDVRRCEYSETAVRQKLDPSGNDSRCVVAAADSSTDS DGKSIIAGVQVVDHDEDIIAPQSLWCTAFKEALWDVALLEVPRWAWQGWKRWRNSESGRR WSAGSASASSLSDLAGEAVGELVGSVVAYVILERLWLAARGWVCETGVEAEEAMARRRQR MLWRMFSRGGDGECSRRCSMEMACEEESAVL 271
5 Protein RL9A F7V996 MSLDAASHQPAARRLLDSALVRRVLACMIIVIMIAISIWILTYVLFL 47
6 Protein RL8A F7V995 MPHGHLRQALSPTSWTCEGLLLLLGLLVLFFHHHNQSAVERRRRVSFVEADRLPHESGWY SSDDDGDRDGDEETGESHNRNSVGLSAVFS 90
7 Uncharacterized protein UL74A C1BEG3 MALTRGGDPAPSVCLVVWFACVYSLLILVVLLLIYRCCIGFQDDLVSRTLAVYRACIQGP ICNQTHNSTS 70
8 Membrane glycoprotein UL8 A0A1P7U1I1 MASDVGSHPLTVTRFRCRVHYVYNKLLILTLFAPVILESVIYVSGPQGGNVTLVSNFTSN ISARWFRWDGNDSHLICFYKRGEGLSTPYVGLSLSCAANQITIFNLTLNDSGRYGAEGFT RSGENETFLWYNLTVKPKPLETTPASNVTTIVTTTSTVTDAKSNVTGNVSLAPQLRAVAG FSHQTPLENNTHLALGEGFVPTMTSSRLSASENYDGNYEFTETANTTRTNTSDWITLGSS ASLLKSTETAVNLSNATTVIPQPVEYPAGGVQYQRAATHYSWMLIIVIILIIFIIICLRA PRKIYHHWKDSKQYGQVFMTDTEL 324
9 Protein UL29/28 Q6SWA3 MSGRRKGCSAATASSSSSSPPSRLPLPGHARRPRRKRCLVPEVFCTRDLADLCVRRDYEG LRRYLRRFEGSCVSLGWPSQCIYVVGGEHSPHSLTEIDLEHCQNDFFGEFRALHLIGTVS HATCRYQVFVDAYGAVFAYDAQEDCLYELASDLAGFFAKGMIRCDPVHESICARLQPNVP LVHPDHRAELCRRSRASARGRYLRSLLAFRELLACEDTAARCAYVEAHREAQLTLIWPEK HSLVLRTARDLGLSASMLRRFQRSLYTREPVMPLGEIEGAEDKTFFHRVRILCGDTGTVY AALVGQDKLVRLSRDLRGFVRVGLALLIDDFRYESIGPVDRSSLYEANPELRLPFKKRRL VVGYFDSLSSLYLRGQPKFSSIWRGLRDAWTHKRPKPRERASGVHLQRYVRATAGRWLPL CWPPLHGIMLGDTQYFGVVRDHKTYRRFSCLRQAGRLYFIGLVSVYECVPDANTAPEIWV SGHGHAFAYLPGEDKVYVLGLSFGEFFENGLFAVYSFFERDYVDEIVEGAWFKHTFAGMY ELSQILHDRANLLRVCQLHAGSKIRLGGSPACTFTFGSWNVAEADEANNFVIGVLEQAHF VVIGWMEPVNKAVFMDAHGGIHVLLYGTMLVKLAETLRGFIRQGSFWFRCPRRFCFSPLD SSATVAAKPVSSHTSPAYDVSEYVFSGRSVLDSVSGTGAS 700
10 Envelope glycoprotein N F5HHQ0 MEWNTLVLGLLVLSVVASSNNTSTASTPRPSSSTHASTTVKATTVATTSTTTATSTSSTT SAKPGSTTHDPNVMRPHAHNDFYNAHCTSHMYELSLSSFAAWWTMLNALILMGAFCIVLR HCCFQNFTATTTKGY 135
11 Tegument protein UL51 homolog F5HEA3 MQLAQRLCELLMCRRKAAPVADYVLLQPSEDVELRELQAFLDENFKQLEITPADLRTFSR DTDVVNHLLKLLPLYRQCQSKCAFLKGYLSEGCLPHTRPAAEVECKKSQRILEALDILIL KLVVGEFAMSEADSLEMLLDKFSTDQASLVEVQRVMGLVDMDCEKSAYMLEAGAAATVAP PTPPAVVQGESGVREDGETVAAVSAFACSSVSDSLIPEETGVTRPMMSLAHINTVSCPTV MRFDQRLLEEGDEEDEVTVMSPSPEPVQQQPPVEPVQQQPQGRGSHRRRYKESAPQETLP TNHEREILDLMRHSPDVPREAVMSPTMVTIPPPQIPFVGSARELRGVKKKKPTAAALLSS A 361
12 Protein TRS1 Q6SVX2 MAQRNGMSPRPPPLGRGRGAGGPSGVGSSPPSSCVPMGATSTAGTGASAAPTATPGHGVH RVEPRGPPGAPPSSGNNSNFWHGPERLLLSQIPVERQALTELEYQAMGAVWRAAFLANST GRAMRKWSQRDAGTLLPLGRPYGFYARVTPRSQMNGVGATDLRQLSPRDAWIVLVATVVH EVDPAADPTVGDKAGHPEGLCAQDGLYLALGAGFRVFVYDLANNTLILAARDADEWFRHG AGEVVRLYRCNRLGVGTPRATLLPQPALRQTLLRAEEATALGRELRRRWAGTTVALQTPG RRLQPMVLLGAWQELAQYEPFASAPHPASLLTAVRRHLNQRLCCGWLALGAVLPARWLGC AAGPATGTTSPPAASGTETEAAGGDAPCAMAGAVGSAVTIPPQPYGGAGGSAICVPNADA HAVVGADATAAAAAAAAAPTVMVGPTAMAGPAASGTVPRAMLVVVLDELGAVFGYCPLDG HVYPLAAELSHFLRAGVLGALALGRESAPAAEAARRLLPELDREQWERPRWDALHLHPRA ALWAREPHGQLAFLLRPGRGEAEVLTLATKHPVICANVEDYLQDARRRADAQALGLDLAT VVMEAGGQMIHKKTKKPKGKEDESVMKGKHSRYTRPTEPPLTPQASLGRALRRDDEDWKP SRVPGEDSWYDLDETFWVLGSNRKNDVYQRRWKKTVLRCGLEIDRPMPTVPKGCRPQTFT HEGIQLMGGATQEPLDTGLYAPSHVTSAFVPSVYMPPTVPYPDPAARLCRDMRRVTFSNV ATHYHYNA 788
13 Protein US34A V9LMJ8 MLKFFLKLRKRRRPVVVPRFVRFIVYVVLFTVAVQRVKQERDAHLRRYEERLQKNRARRR QSFP 64
14 Protein US34 F5HEF3 MNLEQLINVLGLLVWIAARAVSRVGPHGSGLVYRELHDFYGYLQLDLLGPVVAGNRSVRT WREQADRARGTFVRRSGLNTSHILPVGGLSGGSGTLPAGLYRPEEEVFLLLNRCHGPLST PKSACLAEVGVANASFLSRFNVGDFHGASWENGTAPDGEPGVC 163
15 Protein US32 F5HD03 MAMYTSESERDWRRVIHDSHGLWCDCGDWREHLYCVYDSHFQRRPTTRAERRAANWRRQM RRLHRLWCFCQDWKCHALYAEWDGKESDDESSASSSGEAPEQQVPAWKTVRAFSRAYHHR INRGLRGTPPPRNLPGYEHASEGWRFCNRRERREDDLRTRAEPDRVVFQLGGVPPRRHRE TYV 183
16 Protein US31 V9LM33 MSLLEREESWRRVVDYSHNLWCTCGNWQSHVEIQDEEPNCEQPEPAHWLEYVAVQWQARV RDSHDRWCLCNAWRDHALRGRWGTAYSSGSSASSSGFVAESKFTWWKRLRHSTRRWLFRR RRARYTPSNCGESSTSSGQSSGDESNCSLRTHGVYTRGEQH 161
17 Uncharacterized protein US30 F5HB41 MGNPRSPLDRRLRFRNVPFLPPRIAASSTTTARSLKAKTMEMRFTIAWMWFPSVLLILGL LTPPSNGCTVDVGRNVSIREQCRLRNGATFSKGDIEGNFSGPVVVELDYEDIDITGERQR LRFHLSGLGCPTKENIRKDNESDVNGGIRWALYIQTGDAKYGIRNQHLSIRLMYPGEKNT QQLLGSDFSCERHRRPSTPLGKNAEVPPATRTSSTYGVLSAFVVWIGSGLNIIWWTGIVL LAADALGLGERWLRLALSHRDKHHASRTAALQCQRDMLLRQRRRARRLHAVSEGKLQEEK KRQSALVWNVEARPFPSTHQLIVLPPPVASAPPAVPSQPPEYSSVFPPV 349
18 Uncharacterized protein US29 F5HG95 MRCFRWWLYSGWWWLTFGCARTVTVGFVAPTVRAQSTVVRSEPAPPSETRRDNNDTSYFS STSFHSSVSPATSVDRQFRRTTYDRWDGRRWLRTRYGNASACVTGTQWSTNFFFSQCEHY PSFVKLNGVQRWTPVRRPMGEVAYYGGCCMVGGGNRAYVILVSGYGTASYGNALRVDFGR GNCTAPKRTYPRRLELHDGRTDPSRCDPYQVYFYGLQCPEQLVITAHGGVGMRRCPTGSR PTPSRPHRHDLENELHGLCVDLLVCVLLLALLLLELVPMEAVRHPLLFWRRVALSPSTSK VDRAVKLCLRRMLGLPPPPSVAPPGEKKELPAQAALSPPLTTWSLPPFPSTRIPDSPPPP YQLRHATSLVTVPTLLLYTSSDIGDTASETTCVAHATYGEPPEPARSTATVQECTVLTAP NCGIVNNDGAVSEGQDHGDAVHHSLDVVSQCAADTGVVDTSE 462
19 Envelope protein US28 F5HF62 MTPTTTTAELTTEFDYDEDATPCVFTDVLNQSKPVTLFLYGVVFLFGSIGNFLVIFTITW RRRIQCSGDVYFINLAAADLLFVCTLPLWMQYLLDHNSLASVPCTLLTACFYVAMFASLC FITEIALDRYYAIVYMRYRPVKQACLFSIFWWIFAVIIAIPHFMVVTKKDNQCMTDYDYL EVSYPIILNVELMLGAFVIPLSVISYCYYRISRIVAVSQSRHKGRIVRVLIAVVLVFIIF WLPYHLTLFVDTLKLLKWISSSCEFERSLKRALILTESLAFCHCCLNPLLYVFVGTKFRQ ELHCLLAEFRQRLFSRDVSWYHSMSFSRRGSPSRRETSSDTLSDEVCRVSQIIP 354
20 Envelope glycoprotein US27 F5HDK1 MTTSTTTTTNIMLQVSNVTNHTLNSTEIYQLFEYTRFGVWLMCIVGTFLNMLVITTILYY RRKKKSPSDTYICNLAVADLLIVVGLPFFLEYAKHHPKLSREVVCSGLNACFYICLFAGV CFLINLSMDRYCVIVWGVELNRVRNNKRATCWVVIFWILAALMGMPHYLMYSHTNNECVG EFANETSGWFPVFLNTKVNICGYLAPIVLMAYTYNRMVRFIINYVGKWHMQTLHVLLVVV VSFASFWFPFNLALFLESIRLLSGTQNETLQTVITFCLYVGQFLAYVRACLNPGIYILVG TQMRKDMWTTLRVFACCCVKQEIPYQDIDIELQKDIQRRAKHTKRTHYDRKHAPMESGEE EFLL 364
21 Protein US26 F5H991 MRQSYRYASGAVVRRTLKGLRKLILCQDLRQDIRHLVRSYADMNISLPVSAPPGWRLDFV EFEDIFGSAAVTDGPETPWGQLICCEESLESLGVLQFSTTVLPRVHGPRSSSEDEDSDDD DFFVYVEEIEPPSQARLVLLLGRYETVWCLDRDCGVLYYLAHSLDDFARHGLLHCEAIYG EQMRTPLLTTQPDHIICDLRLHDNSISELQRVTCRYRGECVPLRTPGEMTRPLLLCGQAE NLKGVWPFICMETEQFNDLLKFFVDRLCCETMIMGVVGESLPSGVFHADFVILVDRACEF FYFDVSRREIWRLADSVDMLLTVGLLKIYQAGRRFHYAVDDAERLEVPGRCPHENFPFWD RFGTVERVRASTRHHELRYKWLIRKDRFIVRPDWCSMRNSLDEVSGTADVSWDPRIRPDY PQTSDLECAKQYWQELNDHVREQTARYGPVRRYSVWCGMSSRLERAVKRLQQRIPRQNLM NPSLMNQGLCVYYSDEEEDQEEDDTSDDDDQEKETENPQNNIGSLTRTPSSPGSLEGVEE RMLNVMKEAVAEQDRKKTQKKHKIDTAQRRVLTRRAARAAVLEGRPTPKPTMPHPVSYLP FWM 603
22 Tegument protein US24 F5H8S6 MMDPAAGSGPDGAAVVPPELPALPVAAEDPMALYRQVLRDFKELFFCLEPMEITRYVHRN EGRCLSLGPPKGWHVMLRTEDGIITAAKQAASKLICCREPLTPLGYAVILLPEPRRDHHD GMVATPYVVFMGRFSRVYAYDTREKYMVLVSHNLDELARYGVSRSEIAYRDVIHTTLRRM TVPVPRRYPKGARTMHVLFLNDTTPEGSYATAERILGCDVKLHTPGYGTVIMRLMKTVQQ LHRIWPFCALTEVESRRWWWAVRANLATPWYVLGVTGRPRPGRSFVAEVLVLLDWFGAVY AIQMDDPNHYVRRVANTITEFFRMGLLKMVFRHRRFERERQRQTRMEHRHLCPHHHERAV DHKRDILFNEDAALPDERRERERRILQQQYDWLCLTERFDPHEGAWERLDPNTLVLHRYD TNSQSYVLDPDIVGVEAAEREAAGHQDDTGPRLHCLVTTRSSTREGAERVITALVHQSRL VTYSDPFPLKSLTGVREYIQI 501
23 Protein US23 F5HAZ3 MWRTRWEDGAPTFTRNDEFLYCHTRYETFLRVMGDFQGIFECQYSADVLRDWVRNHVDQV LSLGIPHNWFLQVRPGSTMPELRDQLLDDVICCPERLIVLGKCVIMVDDHYEETELVLCM GGGTRLYIYEPSQEILLLCARHLDELARYGMMYTEAVYRQPQTPFATRVPHDVVAMLLRH GHDTDALAACVGEHHGRDVNFHTPGRHAKTLKLLTSFGCLTDCWPFEVAPAARLAECEMY VTLQLRCRWYLLGAVGSYRAGGFFDTSFLIIFDRFCRFYVVIVKSHLDRSPPLQRLAGEI YRLADSLEELFRAGLMKVYVRRRYEHGLRRAARLERNGGCVHMGEAARLHFTMFDSGVDR DYARQFRWLCRGDRFRAEMLNNWDGWDAFTIWQARVVRGDFAERRRPRSLGDGEEEDEGN DGRAMPVVRRRPPPMPRDDDEDNHVVPDNQNLEVIHDALADDEEQGEDDDDSGAEPMEPE ENNVVPNVDRRGGEDAVAARMAAGHESDDDEWEDLGFDLEEDTVFDLKDVDEWFEQRRLA EKERWHLGQRIVNAYRTEAEVSEAEVEARRINLNTDLSPEWVKSFDFREHFV 592
24 Tegument protein US22 F5HDC7 MSLLTKAAAEAWGTYLRQRDERCEDAIRCDYGVFQFRNTVFQKTLSMLQGLYLRQYDPPA LRTYVQRHQGTTVALRNPANWFLVMREQAAIPQIYARSLAADYLCCDDTLEAVGVLAVRP PDSDLTRNTKQAQELPCVLMLSHYGTVYVYDWETDGLYEVASDIKAFSKNGLLWCEYVYR HPQTPFATTEPRYHVQKFLCTDPTDAAAVAKTAREMNGLNLVIRTPGRTEVEPLLMLGSI EGLRACRPFDHMPAADFRDLLNFIRQRLCCEWYVVGLVGYYLAYGPFVPSGMVLLDKFGV VYLHKIEDSDLYRIADNFHMFLKCGLLKLRGLCRFDRGLRGECRLEELPVCHHTLKRDVL RWHGALGTITRSQLESALDWFLRPTRGTDKVPNNSSAWGRTDLLPTGALQDNQNWAFPSH SVETLPALQGGLWEDNDETTQTVDGQRCFRMPKFFPPPMCRAPYNECGVELPGGDSSDED ESGRPRRIANRIGDTPETPCNSENEDDTTVEGTSGGPEAMDSQAPYPSEDSPTTEKEAWL QRGRRAKAMHARGHTLKQVPIPEPDQMGDDGPDPGP 576
25 Membrane protein US21 F5HHT6 MSLRGQVQIARSVFLLRIYILIWVQCLILMSVCAFCWLVLPHRLEQLFSSVRLTLSCLMI SIVCLGLLRWAEPNFPKNVWILLTYTLLTSVAVTASGFHFSHRSVIYAMVATVTLFCFLT LATYLFARDVELQRSLLTGASTLILLLFAVFSLFPEAVSEILVMIAGLAVIVTSVVCDTQ DILHDIEYESYIPGALCLYMDLMYLFVSVLYFMPSEPGSAHTAQTTVAATVAATAAASPQ FVS 243
26 Membrane protein US20 F5HGH8 MQAQEANALLLSRMEALEWFKKFTVWLRVYAIFIFQLAFSFGLGSVFWLGFPQNRNFCVE NYSFFLTVLVPIVCMFITYTLGNEHPSNATVLFIYLLANSLTAAIFQMCSESRVLVGSYV MTLALFISFTGLAFLGGRDRRRWKCISCVYVVMLLSFLTLALLSDADWLQKIVVTLCAFS ISFFLGILAYDSLMVIFFCPPNQCIRHAVCLYLDSMAIFLTLLLMLSGPRWISLSDGAPL DNGTLTAASTTGKS 254
27 Transmembrane protein US19 F5HAR3 MLHVVPLEWTVEEVVPYLERLAVWLRASVLVAFQLTATVALSVLSWWLMPPPVAELCERG RDDDPPSLSHLSLVVPVGCLFLLLRGPSIDRCPRKLPLLLAYCLPHALAFLTLLMCQPSP QAFVGAALLALAVDLSCLGASLLGCDPGASLRRLWLPSVLSLLCATALGLWLLRAAAPFF LGLHATTLLTVTLMLIHDLSLITCQSSFPESFQPSLRLYVENVALFIGMYHLLRLWLWSP 240
28 Protein UL133 Q6SW10 MGCDVHDPSWQCQWGVPTIIVAWITCAALGIWCLAGSSADVSSGPGIAAVVGCSVFMIFL CAYLIRYREFFKDSVIDLLTCRWVRYCSCSCKCSCKCISGPCSRCCSACYKETMIYDMVQ YGHRRRPGHGDDPDRVICEIVESPPVSAPTVFVPPPSEESHQPVIPPQPPTPTSEPKPKK GRAKDKPKGRPKNKPPCEPTVSSQPPSQPTAMPGGPPDASPPAMPQMPPGVAEAVQAAVQ AAMAAALQQQQQHQTGT 257
29 Protein US17 F5H9N9 MSPNSEATGTAWAPPPPRPSRGVIMISSVSTNDVRRFLLCMRVYSTVAVQGTCTFLLCLG LVLAFPHLKGTVFLCCTGFMPPLSLMVPTICLALLHGKRDEGSFTSPPSPGLLTIYSVLT TLSVIVASACSSSTLVTFSGLLACVLFSLCSCVTGLAGHNHRRWQVIVTLFVIGVIAFLI ALYLQPVPLGHKLFLGYYAMALSFMLVVTVFDTTRLFEIAWSEADLLTLCLYENLVYLYL LILILFTTEDSLDKLIAWMTWLSSRATGATNAASISGCDLLREVQRNLTRTMA 293
30 Protein US16 Q6SVZ0 MGLRFPTATQRQIVFRRLFDSGNNDDYDEAAVVAVLGWVHRFEVVVRIAGLLLFQISTAV AVLGSFSLVFPTATLKSRPGFPCHVVWAPEVLLLVPVASALFVYFRYERPVLAQRNRHPR CRRPFRQLVLLLAGLLAHIPALGVTCACQEPREVLTSFVLTLVITLLCAEVVFICRDNCT LSDQFALINGVWVVVFLANVLIVFTRPWTWPLRLLLGFYSTVGLIFAGHFSQQVLFVRHV LMPRDVAHTSLQLFITFISLFFLILRIRNCQDLLSDLRLLELPSSDAMTLTPNDLSHASS STPLSTLSP 309
31 Membrane protein US15 F5HFH0 MRREKGFQVPTDGTVIYVPPGIQETRLATRSLAWVDCCRVALHTYGAVGWQLAGLTALLS AFCYAAPATWFHHSRLCLTESSPSLVFVIPVTSVIFIHCYETSHPSNIGVLLFYTLLHVP PLIVICLCLDGTLVISAALFTLLAFLSCTGVALLAPERTVRRQIVVIHALITLTFTAIVV VILRRGWSWCFKIVLSFSVLITCLAVSHFHEAALAVRYETPLERALLAAVKVFLSLVFTL LMVLRIMTLRTFLQTYFSSDKL 262
32 Membrane protein US14 F5HD92 METVSTQRETASSETERTREAASAETTDATFRSLEEGSTISSRYSETASTASEDAVCWLR RTAIVMRVYGLLTLETAFSVLISALVWLGYPSLGYECRDDPSPLLLSCTPVLVLGALELT DHRHPSNGLVFALYVALLSFTTAGLNLCATAPIGVSSLILTWTLFVACNGVAWEHRLSSV WRDALFTSTLLTVMVSVLASTYTWLHKTLLCLYTVFVGCILAVLFQDVRYIATKMPVSHI IRSSLVLYATETLIYHTTLLMLTPVVWSARWDQMFSYLAKLGTYHHYRVDNGTLSVILNS TTATFQSRVA 310
33 Membrane protein US13 F5H9I4 MDPPLPSLHSPQWASLLQLHHGLMWLRRFAVLVRVYALVVFHIAISTAFCGMIWLGIPDS HNICQHESSPLLLVFAPSLLWCLVLIQGERHPDDVVLTMGYVGLLSVTTVFYTWCSDLPA ILIDYTLVLTLWIACTGAVMVGDSFRAKRWELICSRVLTSVFFITLWVIGDQTVFHHQRI LLYGYGAIVFLMMTVTFYGTRYIRDELPAAQTLRGSLLIYVGLVTMFKITLIVLSPNLWR LPWTTVFAAFRSSYCEGGGGS 261
34 Membrane protein US12 V9LM60 MVQIQFHQGEPLGHKKEKPPPVSPPSPPPIRRVTVITKDEDTLRSVQHFLWMVRLYGTVV FQTSATIATTILFMLIPWRVTTPYLRDTLPFWSTLLPCALRCHAYWLERQRRPGTLMLVM VYTTLTTISVSTIGLCFDRTVVIQAYVLSSMLCVWCTGLAWLMAWNMQRRLAILCLLSFM LPILWLFIAVQSWEPYQRIILALTVSFIYGLKIVLIRDTLTVLYRSPSNCYTDGDLLRTA MLLYMDQVIMFLLVVVPLTAPIWYPNYAGALGRTAHWLFHK 281
35 Membrane glycoprotein US11 Q6SVZ5 MNLVMLILALWAPVAGSMPELSLTLFDEPPPLVETEPLPPLPDVSEYRVEYSEARCVLRS GGRLEALWTLRGNLSVPTPTPRVYYQTLEGYADRVPTPVEDISESLVAKRYWLRDYRVPQ RTKLVLFYFSPCHQCQTYYVECEPRCLVPWVPLWSSLEDIERLLFEDRRLMAYYALTIKS AQYTLMMVAVIQVFWGLYVKGWLHRHFPWMFSDQW 215
36 Membrane glycoprotein US10 F5HFJ7 MLRRGSLRNPLAICLLWWLGVVAAATEETREPTYFTCGCVIQNHVLKGAVKLYGQFPSPK TLRASAWLHDGENHERHRQPILVEGTATATEALYILLPTELSSPEGNRPRNYSATLTLAS RDCYERFVCPVYDSGTPMGVLMNLTYLWYLGDYGAILKIYFGLFCGACVITRSLLLICGY YPPRE 185
37 Membrane glycoprotein US9 F5HC33 MILWSPSTCSFFWHWCLIAVSVLSSRSKESLRLSWSSDESSASSSSRICPLSNSKSVRLP QYPRGFGDVSGYRVSSSVSECYVQHGVLVAAWLVRGNFSDTAPRAYGTWGNERSATHFKV GAPQLENDGALRYETELPQVDARLSYVMLTVYPCSACNRSVLHCRPASRLPWLPLRVTPS DLERLFAERRYLTFLYVVLVQFVKHVALFSFGVQVACCVYLRWIRPWVRGRHRATGRTSR EEEAKDD 247
38 Membrane glycoprotein US8 F5HB52 MRRWLRLLVGLGCCWVTLAHAGNPYEDDDYYYYREDEPRQHGEPNYVAPPARQFRFPPLN NVSSYQASCVVKDGVLDAVWRVQGTFYPEKGIVARVGWSGRRGRKWGRLHAPECLVETTE AVFRLRQWVPTDLDHLTLHLVPCTKCKPMWCQPRYHIRYFSYGNSVDNLRRLHYEYRHLE LGVVIAIQMAMVLLLGYVLARTVYRVSSAYYLRWHACVPQKCEKSLC 227
39 Membrane glycoprotein US7 F5HDD3 MRIQLLLVSTLVASIVATRVEDMATFRTEKQWQQDLQYRREFVKRQLAPKPKSNIVVSHT VSCVIDGGNMTSVWRFEGQFNPHIASEVILHDTSGLYNVPHEVQNDGQVLTVTVKRSAPA DIAKVLISLKPVQLSSGQYECRPQLQLPWVPRPSSFMYDSYRLWYEKRWLTIILYVFMWT YLVTLLQYCIVRFIGTRLFYFLQRNITIRFTGKPTYNLLTYPVKG 225
40 Unique short US6 glycoprotein Q6SW00 MDLLIRLGFLLMCALPTPGERSSRDPKTLLSLSPRQACVPRTKSHRPVCYNDTGDCTDAD DSWKQLGEDFAHQCLQAAKKRPKTHKSRPNDRNLEGRLTCQRVRRLLPCDLDIHPSHRLL TLMNNCVCDGAVWNAFRLIERHGFFAVTLYLCCGITLLVVILALLCSITYESTGRGIRRC GS 182
41 Membrane glycoprotein US3 F5HEU0 MKPVLVLAILAVLFLRLADSVPRPLNVVVSEIKSAHFRVEENQCWFHMGMLYFKGRMSGN FTKKHFVNVGIVSQSYMDRLQVSGEQYHHDERGAYFEWNIGGYPVSHTVDMVDITLSTRW GDPKKYAACVPQVRMDYSSQTINWYLQRSMRDDNWGLLFRTLLVYLFSLVVLVLLTVGVS ARLRFI 186
42 Unique short US2 glycoprotein (Protein HQLF2) (gpUS2) F5HE05 MNNLWKAWVGLWTSMGPLIRLPDGITKAGEDALRPWKSTAKHPWFEIEDNRCYIDNGKLF ARGSIVGNMSRFVFDPKADYGGVGENLYVHADDVEFVPGESLKWNVRNLDVMPIFETLAL RLVLQGDVIWLRCVPELRVDYTSSAYMWNMQYGMVRKSYTHVAWTIVFYSINITLLVLFI VYVTVDCNLSMMWMRFFVC 199
43 Protein US1 Q6SW03 MASGLGDLSVGVSSLPMRELAWRRVADDSHDLWCCCMDWKAHVEYAHPASELRPGSGGWP EHAEAQWRQQVHAAHDVWCNCGDWQGHALRSRSRTAESGRSSSSSSVSVLSDGDQQPWWR RLRVKRPKFPSWARRWTQRHDSEERASQQAKNDSTS 156
44 Protein IRS1 Q6SW04 MAQRNGMSPRPPPLGRGRGAGGPSGVGSSPPSSCVPMGATSTAGTGASAAPTATPGHGVH RVEPRGPPGAPPSSGNNSNFWHGPERLLLSQIPVERQALTELEYQAMGAVWRAAFLANST GRAMRKWSQRDAGTLLPLGRPYGFYARVTPRSQMNGVGATDLRQLSPRDAWIVLVATVVH EVDPAADPTVGDKAGHPEGLCAQDGLYLALGAGFRVFVYDLANNTLILAARDADEWFRHG AGEVVRLYRCNRLGVGTPRATLLPQPALRQTLLRAEEATALGRELRRRWAGTTVALQTPG RRLQPMVLLGAWQELAQYEPFASAPHPASLLTAVRRHLNQRLCCGWLALGAVLPARWLGC AAGPATGTTSPPAASGTETEAAGGDAPCAMAGAVGSAVTIPPQPYGGAGGSAICVPNADA HAVVGADATAAAAAAAAAPTVMVGPTAMAGPAASGTVPRAMLVVVLDELGAVFGYCPLDG HVYPLAAELSHFLRAGVLGALALGRESAPAAEAARRLLPELDREQWERPRWDALHLHPRA ALWAREPHGQWEFMFREQRGDPIHDPVAFRLSDARTLGLDLTTVMTERQSQLPEKYIGFY QIRKPPWLMEQPPPPSRQTKPDAATMPPPLSAQASVSYALRYDDESWRPLSTVDDHKAWL DLDESHWVLGDSRPDDIKQRRLLKATQRRGAEIDRPMPVVPEECYDQRFTTEGHQVIPLC ASEPEDDDEDPTYDELPSRPPQKHKPPDKPPRLCKTGPGPPPLPPKQRHGSTDGKVSAPR QSEHHKRQTRPPRPPPPKFGDRTAAHLSQNMRDMYLDMCTSSGHRPRPPAPPRPKKCQTH APHHVHH 847
45 Uncharacterized protein UL150 Q6SW05 MLTLYLFTATCCFVCALPRQAQVDTAICHHTWPMCSDVPHPTSSAHNTALSSSHAISIEH RLLHSPSPPRENIRHSMRCRRRAIASSASTPVSHTQPLAANHRRSRITYATTDPTNSPTA SPAKSDKLEADADPALHRRPDSLLRHLFQPCHAQRGTSNRATSQRASLNAVHHKLCGAMI SSSWSTTCTPAIMDLPSLSVELSAGHKKKETPTEGGWGGEEGEDDVLATIRNTLSAPTSP AAATTHRLSFPEGSSFCLTAVSEYSQRLTSTAALTPPPPAVAAPFSFSSTVSETGAFPQS TAGRTRVDDTAVVTAGDPRSPVTHVTLLQIFRLRSSLLTSRSGDTLRGGEHEAIPKVASL FWTLLKATQTVEITHKTPSADSHRNPQKYTDRPQRLLLTALAIWQRTYNNTRADHAPQVR LLGNILTYRRPQTATASAKAHTQQQPEEPKGQQIWAQTAGQAAPHGDEPHSDGELRRESH SAPPTSRTLPDTILAVKRRSVAQRSHVRLDAKPGLNDRDGFRRRLLLPLSGYFRANELRN QQFMGYGTENGLKNTCLTRPLGAAGGVRETIGERQDRDVADSATQRVFHTLYAALQTVRV WYTALGTAWRTSGSRTRDSLFDGPRRRDRQAGRLRRLEL 639
46 Protein UL148D F5HHL7 MTAPKCVTTTTYLVKTKEQPWWPDNAIRRWWISVAIVIFIGVCLVALMYFTQQQARNGSG SG 62
47 Protein UL148C F5HDE7 MLTPAVFPAVLYLLALVVWVEMFCLVAVAVVEREIAWALLLRMLVVGLMVEVGAAAAWTF VRCLAYQRSFPVLTAFP 77
48 Protein UL148B F5HAK6 MALDTLAGLAICVGLVMGVTVIASCALLVFYYCDEREDGRPSKLLQRSIRRWRHGLSTES LTAILPDGSSTEQEIYHTRL 80
49 Protein UL148A F5HE74 MSSDSNFDPWIPVCVVVVMTSVVLFAGLHVYLWYVRRQLVAFCLEKVCVRCCGKDETTPL VEDAEPPAELEMVEVSDECY 80
50 Protein UL133 Q6SW10 MGCDVHDPSWQCQWGVPTIIVAWITCAALGIWCLAGSSADVSSGPGIAAVVGCSVFMIFL CAYLIRYREFFKDSVIDLLTCRWVRYCSCSCKCSCKCISGPCSRCCSACYKETMIYDMVQ YGHRRRPGHGDDPDRVICEIVESPPVSAPTVFVPPPSEESHQPVIPPQPPTPTSEPKPKK GRAKDKPKGRPKNKPPCEPTVSSQPPSQPTAMPGGPPDASPPAMPQMPPGVAEAVQAAVQ AAMAAALQQQQQHQTGT 257
51 Protein UL135 F5HAQ7 MVWLWLGVGLLGGTGLASLVLAISLFTQRRGRKRSDETSSRGRLPGAASDKRGACACCYR IPKEDVVEPLDLELGLMRVATHPPTPQVPRCTSLYIGEDGLPIDKPEFPPARFEIPDVST PGTPTSIGRSPSHCSSSSSLSSSASVDTVLHQPPPSWKPPPPPGRKKRPPTPPVRAPTTR LSSHRPPTPIPAPRKNLSTPPTKKTPPPTKPKPVGWTPPVTPRPFPKTPTPQKPPRNPRL PRTVGLENLSKVGLSCPCPRPRTPTEPTTLPIVSVSELAPPPRWSDIEELLEKAVQSVMK DAESMQMT 308
52 Protein UL136 F5HF35 MSVKGVEMPEMTWDLDVGNKWRRRKVLSRIHRFWECRLRVWWLSDAGVRETDPPRPRRRP TWMTAVFHVICAVLLTLMIMAIGALIAYLRYYHQDSWRDMLHDLFCGCHYPEKCRRHHER QRSRRRAMDVPDPELGDPARRPLNGAMYYGSGCRFDTVEMVDETRPAPPALSSPETGDDS NDDAVAGGGAGGVTSSATRTTSSNALLPEWMDAVHVAVQAAVQATVQVSGPRENAVSPAT 240
53 Protein UL138 F5HGQ8 MDDLPLNVGLPIIGVMLVLIVAILCYLAYHWHDTFKLVRMFLSYRWLIRCCELYGEYERR FADLSSLGLGAVRRESDRRYRFSERPDEILVRWEEVSSQCSYASSRITDRRAGSSSSSSV HVANQRNSVPPPDMAVTAPLTDVDLLKPVTGSATQFTTVAMVHYHQEYT 169
54 Membrane glycoprotein UL139 Q6SW14 MLWILVLFALAASASETTTGTSSNSSQSTSAGTTNTTTPSTACINASNGSDLGAPQLALL AASGWTLSGLLLIFTCCLCCFWLVRKVCSCCGNSSESESKATHAYTNAAFTSSDATLPMG TTGSYTPPQDGSFPPPPR 138
55 Protein UL140 F5HCK7 MTPAQTNGTTTVHPHGAKNGSGGSALPTLVVFGFIVTLLFFLFMLYFWNNDVFRKLLRCA WIQRCCDRFDAWQDEVIYRRPSRRSQSDDESRTNSVSSYVLLSPASDGGFDNPALTEAVD SVDDWATTSVFYATSDETADTERRDSQQLLIELPPEPLPPDVVAAMQKAVKRAVQNALRH SHDSWQLHQTL 191
56 Protein UL141 Q6RJQ3 MCRRESLRTLPWLFWVLLSCPRLLEYSSSSFPFATADIAEKMWAENYETTSPAPVLVAEG EQVTIPCTVMTHSWPMVSIRARFCRSHDGSDELILDAVKGHRLMNGLQYRLPYATWNFSQ LHLGQIFSLTFNVSTDTAGMYECVLRNYSHGLIMQRFVILTQLETLSRPDEPCCTPALGR YSLGDQIWSPTPWRLRNHDCGMYRGFQRNYFYIGRADAEDCWKPACPDEEPDRCWTVIQR YRLPGDCYRSQPHPPKFLPVTPAPPADIDTGMSPWATRGIAAFLGFWSIFTVCFLCYLCY LQCCGRWCPTPGRGRRGGEGYRRLPTYDSYPGVKKMKR 338
57 Membrane glycoprotein UL142 F5HHH2 MRIEWACWLFGYFVSSVGSERSLSYRYHLESNSSANVVCNGNISVFVNGTLGVRYNITVG ISSSLLIGHLTIQTLESWFTPWVQNKSYSKQPLSTTETLYNIDSENIHRVSQYFHTRWIK SLQENHTCDLTNSTPTYTYQANVNNTNYLTLTSSGWQDRLNYTAINSTHFNLTESNITSI HKYLNTTCIERLRNYTLEPVYTTAVPQNVTPEHAITTLYTTPPNAITIKDTTQSHTVQTP SFNDTHNVTEHTLNISYVLSQKTNNTTSPWVYAIPMGATATIGAGLYIGKHFTPVKFVYE VWRGQ 305
58 Membrane glycoprotein UL144 (TNF alpha-like receptor UL144) (UL144 protein) F5HAM0 MKPLVMLICFGVILLQLGVTKVCQHNEVQLGNECCPPCGLGQRVTKVCTERTSVTCTPCP NGTYVSGLYNCTDCTQCNVTQVMIRNCTSTNNTVCAPKNHTYFSTPGVQHHKQRQQNHTA HITVKQGKSGRHTLAWLSLFIFLVGIILLILYLIAAYRSERCQQCCSIGKIFYRTL 176
59 Protein UL145 F5HF44 MYGVLAHYYSFISSPSVMVNFKHHNAVQLLCARTRDGTAGWERLTHHASYHANYGAYAVL MATSQRKSLVLHRYSAVTAVALQLMPVEMLRRLDQSDWVRGAWIVSETFPTSDPKGFWSD DDSPMGGSED 130
60 Chemokine vCXCL1 F5HBX1 MRLIFGALIISLTYMYYYEVHGTELRCKCLDGKKLPPKTIMLGNFWFHRESGGPRCNNNE YFLYLGGGKKHGPGVCLSPHHPFSKWLDKRNDNRWYNVNVTRQPERGPGKITVTLVGLKE 120
61 Putative viral CXC chemokine 2, vCXCL2 F5HA06 MLLTWLHHPILNSRIKLLSVRYLSLTAYMLLAICPIAVRLLELEDYDKRCRCNNQILLNT LPVGTELLKPIAASESCNRQEVLAILKDKGTKCLNPNAQAVRRHINRLFFRLVLDEEQRI YDVVSTNIEFGAWPVPTAYKAFLWKYAKKLNYHYFRLRW 159
62 Uncharacterized protein UL147A F5H8R0 MSLFYRAVALGTLSALVWYSTSILAEINENSCSSSSVDHEDCEEPDEIVREEQDYRALLA FSLVICGTLLVTCVI 75
63 Membrane protein UL148 F5H8Q3 MLRLLFTLVLLALYGPSVDASRDYVHVRLLSYRGDPLVFKHTFSGVRRPFTELGWAACRD WDSMHCTPFWSTDLEQMTDSVRRYSTVSPGKEVTLQLHGNQTVQPSFLSFTCRLQLEPVV ENVGLYVAYVVNDGERPQQFFTPQVDVVRFALYLETLSRIVEPLESGRLTVEFDTPDLAL APDLVSSLFVAGHGETDFYMNWTLRRSQTHYLEEMALQVEILKPRGVRHRAIIHHPKLQP GVGLWIDFCVYRYNARLTRGYVRYTLSPKARLPAKAEGWLVSLDRFIVQYLNTLLITMMA AIWARVLITYLVSRRR 316
64 Envelope glycoprotein UL132 F5HGU6 MPAPRGPLRATFLALVAFGLLLQIDLSDVTNVTSSTKVPTSTSNRNSVDNATSSGPTTGI NMTTTHESSVHNVRNNEIMKVLAILFYIVTGTSIFSFIAVLVAVVYSSCCKHPGRFRFAD EEAVNLLDDTDDSGGSSPFGSGSRRGSQIPAGFCSSSPYQRLETRDWDEEEEASAARERM KHDPENVIYFRKDGNLDTSFVNPNYGRGSPLTIESHLSDNEEDPIRYYVSVYDELTASEM EEPSNSTSWQIPKLMKVAMQPVSLRDPEYD 270
65 Protein UL131A F5HET4 MRLCRVWLSVCLCAVVLGQCQRETAEKNDYYRVPHYWDACSRALPDQTRYKYVEQLVDLT LNYHYDASHGLDNFDVLKRINVTEVSLLISDFRRQNRRGGTNKRTTFNAAGSLAPHARSL EFSVRLFAN 129
66 Envelope glycoprotein UL130 F5HCP3 MLRLLLRHHFHCLLLCAVWATPCLASPWSTLTANQNPSPPWSKLTYSKPHDAATFYCPFL YPSPPRSPLQFSGFQRVSTGPECRNETLYLLYNREGQTLVERSSTWVKKVIWYLSGRNQT ILQRMPRTASKPSDGNVQISVEDAKIFGAHMVPKQTKLLRFVVNDGTRYQMCVMKLESWA HVFRDYSVSFQVRLTFTEANNQTYTFCTHPNLIV 214
67 Uncharacterized protein UL124 F5HHS3 MERNSLLVCQLLCLVARAAATSTAQTTLPSTVNSTATGVTSDSQQNTTQLPASSAAALSL PSASAVQAHSPSSFSDTYPTATALCGTLVVVGIVLCLSLASTVRSKELPSDHEPLEAWEQ GSDVEAPPLPEKSPCPEHVPEIRVEIPRYV 150
68 55 kDa immediate-early protein 1 F5HCM1 MESSAKRKMDPDNPDEGPSSKVPRPETPVTKATTFLQTMLRKEVNSQLSLGDPLFPELAE ESLKTFEQVTEDCNENPEKDVLTELVKQIKVRVDMVRHRIKEHMLKKYTQTEEKFTGAFN MMGGCLQNALDILDKVHEPFEDMKCIGLTMQSMYENYIVPEDKREMWMACIKELHDVSKG AANKLGGALQAKARAKKDELRRKMMYMCYRNIEFFTKNSAFPKTTNGCSQAMAALQNLPQ CSPDEIMSYAQKIFKILDEERDKVLTHIDHIFMDILTTCVETMCNEYKVTSDACMMTMYG GISLLSEFCRVLCCYVLEETSVMLAKRPLITKPEVISVMKRRIEEICMKVFAQYILGADP LRVCSPSVDDLRAIAEESDEEEAIVAYTLATAGASSSDSLVSPPESPVPATIPLSSVIVA ENSDQEESEQSDEEQEEGAQEEREDTVSVKSEPVSEIEEVASEEEEDGAEEPTASGGKST HPMVTRSKADQ 491
69 Viral transcription factor IE2, IE2 (Protein UL122) Q6SW29 MESSAKRKMDPDNPDEGPSSKVPRPETPVTKATTFLQTMLRKEVNSQLSLGDPLFPELAE ESLKTFEQVTEDCNENPEKDVLTELGDILAQAVNHAGIDSSSTGPTLTTHSCSVSSAPLN KPTPTSVAVTNTPLPGASATPELSPRKKPRKTTRPFKVIIKPPVPPAPIMLPLIKQEDIK PEPDFTIQYRNKIIDTAGCIVISDSEEEQGEEVETRGATASSPSTGSGTPRVTSPTHPLS QMNHPPLPDPLGRPDEDSSSSSSSSCSSASDSESESEEMKCSSGGGASVTSSHHGRGGFG GAASSSLLSCGHQSSGGASTGPRKKKSKRISELDNEKVRNIMKDKNTPFCTPNVQTRRGR VKIDEVSRMFRHTNRSLEYKNLPFMIPSMHQVLEEAIKVCKTMQVNNKGIQIIYTRNHEV KNEVDQVRCRLGSMCNLALSTPFLMEHTMPVTHPPDVAQRTADACNDGVKAVWNLKELHT HQLCPRSSDYRNMIIHAATPVDLLGALNLCLPLMQKFPKQVMVRIFSTNQGGFMLPIYET AAKAYAVGQFEKPTETPPEDLDTLSLAIEAAIQDLRNKSQ 580
70 Membrane protein UL121 F5HD27 MWGCGWSRILVLLLLMCMALMARGTYGAYICSPNPGRLRISCALSVLDQRLWWEIQYSSG RLTRVLVFHDEGEEGDDVHLTDTHHCTSCTHPYVISLVTPLTINATLRLLIRDGMYGRGE KELCIAHLPTLRDIRTCRVDADLGLLYAVCLILSFSIVTAALWKVDYDRSVAVVSKSYKS 180
71 Membrane protein UL120 Q6SW31 MYRAGVTLLVVAVVSFGRWDSVTVATTIRVGWWYEPQVKMAYIYEHNDTNLTIFCNTTAY DSPFLASGMMIVLPHRTQFLTRKVNYSEDMENIKQNYTHQLTHMLTGEPGTYVNGSVTCW GSNGTFGAGTFIVRSMVNKTAGNTNTFIHFVEDSELVENPAYFRRSDHRAFMIVILTQVV FVVFIINASFIWSWTFRRHKR 201
72 Viral Fc-gamma receptor-like protein UL119 (gp68) F5HC14 MCSVLAIALVVALLGDMHPGVKSSTTSAVTSPSNTTVTSTTSISTSNNVSSAVTTTVQTS TSSASTSVIATTQKEGHLYTVNCEASYSYDQVSLNATCKVILLNNTKNPDILSVTCYART DCKGPFTQVGYLSAFPSNDKGKLHLSYNATAQELLISGLRPQETTEYTCSFFSWGRHHNA TWDLFTYPIYAVYGTRLNATTMRVRVLLQEHEHCLLNGSSLYHPNSTVHLHQGDQLIPPW NISNVTYNGQRLREFVFYLNGTYTVVRLHVQIAGRSFTTTYVFIKSDPLFEDRLLAYGVL AFLVFMVIILLYVTYMLARRRDWSYKRLEEPVEEKKHPVPYFKQW 345
73 Protein UL117, pUL117 F5HFA5 MVMFSQDHVQIVYGSTRICKSLAPANKRKTHRTIVVAPRRGFLRIPPDGQDVNHVKIVPT TTSSSLAPPRDDERRPTPPLRPPLTVYPYGTSLIRRSARDAKLRSKLIVFHITRPALGQH PQNPGISGPAAMDHSEFLTSFRREVDRQTVLTAESAPATVEVCLGDALPGGVMGGGGLPA GVGSASAAVAAAAAAVAGVPVAANPVMPATATVTTPPMIDLTSHHRPLTLFTPASAAAAP AVATNGGNATYILPADCRYAPLFASKYKYVFEEVSRLMRLHDSTAVQLQISASCGNAFQA LKSALLKLHNVTVLAGQQLITQTMPHTPQAVATFKFFHQDPNRVLDCIRPVVPRSTSYHE TGVYQMWVSGATKKDLFDAVTLCASIVEKQPDVFNINVSLLTYPSIAAPHLPLYNEFTSF RLPTS 425
74 Uncharacterized protein UL116 Q6SW34 MKRRRRWRGWLLFLALCFCLLCEAVETNATTVTSTTAAAATTNTTVATTGTTTTSPNVTS TTSNTVTTPTTVSSVSNLTSSATSILISTSTVSGTRNTRNNNTTTIGTNATSPSSSVSIL TTVTPAATSTTSNNGDVTSDYTPTFDLENITTTRAPTRPPAQDLCSHNLSIILYEEESQS SVDIAVDEEEPELEDDDEYDELWFPLYFEAECNLNYTLQYVNHSCDYSVRQSSVSFPPWR DIDSVTFVPRNLSNCSAHGLAVIVAGNQTWYVNPFSLAHLLDAIYNVLGIEDLSANFWRQ LAPYRHTLIVPQT 313
75 Envelope glycoprotein L, gL F5HCH8 MCRRPDCGFSFSPGPVILLWCCLLLPIVSSAAVSVAPTAAEKVPAECPELTRRCLLGEVF EGDKYESWLRPLVNVTGRDGPLSQLIRYRPVTPEAANSVLLDEAFLDTLALLYNNPDQLR ALLTLLSSDTAPRWMTVMRGYSECGDGSPAVYTCVDDLCRGYDLTRLSYGRSIFTEHVLG FELVPPSLFNVVVAIRNEATRTNRAVRLPVSTAAAPEGITLFYGLYNAVKEFCLRHQLDP PLLRHLDKYYAGLPPELKQTRVNLPAHSRYGPQAVDAR 278
76 Uracil-DNA glycosylase, UDG, EC 3.2.2.27 (UNG) F5HI85 MALKQWMLANIADNKGSLLTPDEQARVFCLSADWIRFLSLPDHDTVLLRDTVAAVEGARQ LEMVYPAPEHVHRWSYLCPPEQVRVVIVGQDPYCDGSASGLAFGTLAGRPPPPSLNNVFR ELARTVDGFQRPASGCLDAWARRGVLLLNTVFTVVHGQPGSHRHLGWQTLSNHVIRRLSE RREHLVFMLWGADAHTCEYLIDRRRHLVLKSCHPSPRNTTRAFVGNDHFILANAYLDTHY RETMDWRLCG 250
77 Early phosphoprotein p84 Q6SW37 MDLPTTVVRKYWTFTNPNRILHQSVNQTFDVRQFVFDNARLVNCVDGDGKVLHLNKGWLC ATIMQHGEASAGAKTQQGFMSIDITGDGELQEHLFVRGGIVFNKSVSSVVGSSGPNESAL LTMISENGNLQVTYVRHYLKNHGESSGGGGGCGAASTASAVCVSSLGGSGGTRDGPSAEE QQRRRQEQRHEERRKKSSSSAGGGGGGGASGGGGGGGSGGQHSSDSANGLLRDPRLMNRQ KERRPPPSSENDGSPPLREAKRQKTTAQHEGHGGGGKNETEQQSGGAGGGGGGGSGRMSL PLDTSEAVAFLNYSSSSSAVSSSSNNHHHHHHHHNAVTDVAAGTDGALLLPIERGAVVSS PSSTSPSSLLSLPRPSSAHSAGETVQESEAAATAAAAGLMMMRRMRRAPAEAAEAPPQSE EENDSTTPVSNCRVPPNSQESAAPQPPRSPRFDDIIQSLTKMLNDCKEKRLCDLPLVSSR LLPETSGGTVVVNHSSVARTAAAVSTAGVGPPAVACPPLVTTGVVPSGSVAGVAPVAAAV ETPAAPPRPVCEIKPYVVNPVVATAAAASNSSSSSSAPLPPPPPPPGGRRGRARNNTRGG GGGGGGGRNSRRQAASSSSSSSRRSRRRNNRHEDEDNDPLLRLSQVAGSGRRRGPSFLED GLEIIDPSEEAAIAAASIAAFFDD 684
78 Viral interleukin-10 homolog, cmvIL-10, vIL-10 F5HC71 MLSVMVSSSLVLIVFFLGASEEAKPATTTTIKNTKPQCRPEDYATRLQDLRVTFHRVKPT LQREDDYSVWLDGTVVKGCWGCSVMDWLLRRYLEIVFPAGDHVYPGLKTELHSMRSTLES IYKDMRQCPLLGCGDKSVISRLSQEAERKSDNGTRKGLSELDTLFSRLEEYLHSRK 176
79 DNA replication helicase, EC 3.6.4.- F5HEN8 MSMTASSSTPRPTPKYDDALILNLSSAAKIERIVDKVKSLSRERFAPEDFSFQWFRSISR VERTTDNNPSAATTAAATATVHSSVSSSAAAAASSEAGGTRVPCVDRWPFFPFRALLVTG TAGAGKTSSIQVLAANLDCVITGTTVIAAQNLSAILNRTRSAQVKTIYRVFGFVSKHVPL ADSAVSHETLERYRVCEPHEETTIQRLQINDLLAYWPVIADIVDKCLNMWERKAASASAA AAAAACEDLSELCESNIIVIDECGLMLRYMLQVVVFFYYFYNALGDTRLYRERRVPCIIC VGSPTQTEALESRYDHYTQNKSVRKGVDVLSALIQNEVLINYCDIADNWVMFIHNKRCTD LDFGDLLKYMEFGIPLKEEHVAYVDRFVRPPSSIRNPSYAAEMTRLFLSHVEVQAYFKRL HEQIRLSERHRLFDLPVYCVVNNRAYQELCELADPLGDSPQPVELWFRQNLARIINYSQF VDHNLSSEITKEALRPAADVVATNNPSVQAHGGGGSVIGSTGGNDETAFFQDDDTTTAPD SRETLLTLRITYIKGSSVGVNSKVRACVIGYQGTVERFVDILQKDTFIERTPCEQAAYAY SLVSGLLFSAMYYFYVSPYTTEEMLRELARVELPDVSSLCAAAAATAAAPAWSGGENPIN NHVDADSSQGGQSVPVSQRMEHGQEETHDIPCLSNHHDDSDAITDAELMDHTSLYADPFF LKYVKPPSLALLSFEETVHMYTTFRDIFLKRYQLMQRLTGGRFATLPLVTYNRRNVVFKA NCQISSQTGSFVGMLSHVSPAQTYTLEGYTSDNVLSLPSDRHRIHPEVVQRGLSRLVLRD ALGFLFVLDVNVSRFVESAQGKSLHVCTTVDYGLTSRTAMTIAKSQGLSLEKVAVDFGDH PKNLKMSHIYVAMSRVTDPEHLMMNVNPLRLPYEKNTAITPYICRALKDKRTTLIF 956
80 Portal protein D2K3R0 MERNHWNEKSSGAKRSRERDLTLSTIRSILAADERLRIKASSYLGVGRGVDDEAVIDIFP TGQTMSFLRLLHGFLGTCRGQSMHQVLRDPCVLRKQLLYGVCKTLFDTITVRRVAEEWKL HAALFPYRALDEEDLEQYLLVWSASLRQSVQTGVLGALRDILYQYADNDDYGLYVDWCVT VGLVPLLDVKTKPSEAAERAQFVRAAVQRATETHPLAQDLLQANLALLLQVAERLGAVRI ANAPEVRVFKKVRSERLEAQLRGKHIRLYVAAEPLAYERDKLLFTTPVAHLHEEILRYDG LCRHQKICQLLNTFPVKVVTASRHELNCKKLVEMMEQHDRGSDAKKSIMKFLLNVSDSKS RIGIEDSVESFLQDLTPSLVDQNRLLPARGPGGPGVVGPGGAVVGGPAGHVGLLPPPPGP AAPERDIRDLFKKQVIKCLEEQIQSQVDEIQDLRTLNQTWENRVRELRDLLTRYASRRED SMSLGARDAELYHLPVLEAVRKARDAAPFRPLAVEDNRLVANSFFSQFVPGTESLERFLT QLWENEYFRTFRLRRLVTHQGAEEAIVYSNYTVERVTLPYLCHILALGTLDPVPEAYLQL SFGEIVAAAYDDSKFCRYVELICSREKARRRQMSREAAGGVPERGTASSGGPGTLERSAP RRLITADEERRGPERVGRFRNGGPDDPRRAGGPYGFH 697
81 Cytoplasmic envelopment protein 1 F5HA10 MEALMIRGVLEVHTDFTRQNVMIMEPQVLDFTVRGDKLWLHTEHGLLVSMAEYRSELLCT SAFLGYSAVFLLETEDAVTQVRLSDLRLKHRCGIVKADNLLHFALCTVISCVENCNLTRK CLHDLLQYLDAVNVRESFGRLLHHSARRLICSALYLLFEEKEPHIVQYVPATFVLFQQTR HTCLQLVARFFFRLTGQDEAHSFSLKLTERKTVDGWPVGLGLLDVLNANYPNLPSPPKLP PRWERGEEE 249
82 DNA helicase/primase complex-associated protein, HEPA (Primase-associated factor) F5HIG1 MTAQPPLHHRHHPYTLFGTSCHLSWYGLLEASVPIVQCLFLDLGGGRAEPRLHTFVVRGD RLPPAEVRAVHRASYAALASAVTTDADERRRGLEQRSAVLARVLLEGSALIRVLARTFTP VQIQTDASGVEILEAAPALGVETTALSNALSLFHVAKLVVIGSYPEVHEPRVVTHAAERV SEEYGTHAHKKLRRGYYAYDLAMSFRVGTHKYVLERDDEAVLARLFEVREVCFLRTCLRL VTPVGFVAVAVTDEQCCLLLQSAWTHLYDVLFRGFAGQPPLRDYLGPDLFETGAARSFFF PGFPPVPVYAVHGLHTLMRETALDAAAEVLSWCGLPDIVGSAGKLEVEPCALSLGVPEDE WQVFGTEAGGGAVRLNATAFRERPAGGDRRWLLPPLPRDDGDGENNVVEVSSSTGGAHPP SDDATFTVHVRDATLHRVLIVDLVERVLAKCVRARDFNPYVRYSHRLHTYAVCEKFIENL RFRSRRAFWQIQSLLGYISEHVTSACASAGLLWVLSRGHREFYVYDGYSGHGPVSAEVCV RTVVDCYWRKLFGGDDPGPTCRVQESAPGVLLVWGDERLVGPFNFFYGNGGAGGSPLHGV VGGFAAGHCGGACCAGCVVTHRHSSGGGGSGVGDADHASGGGLDAAAGSGHNGGSDRVSP STPPAALGGCCCAAGGDWLSAVGHVLGRLPALLRERVSVSELEAVYREILFRFVARRNDV DFWLLRFQPGENEVRPHAGVIDCAPFHGVWAEQGQIIVQSRDTALAADIGYGVYVDKAFA MLTACVEVWARELLSSSTASTTTCSSSSVLSSALPSVTSSSSGTATVSPPSCSSSSATWL EERDEWVRSLAVDAQHAAKRVASEGLRFFRLNA 873
83 Envelope glycoprotein M, gM Q6SW43 MAPSHVDKVNTRTWSASIVFMVLTFVNVSVHLVLSNFPHLGYPCVYYHVVDFERLNMSAY NVMHLHTPMLFLDSVQLVCYAVFMQLVFLAVTIYYLVCWIKISMRKDKGMSLNQSTRDIS YMGDSLTAFLFILSMDTFQLFTLTMSFRLPSMIAFMAAVHFFCLTIFNVSMVTQYRSYKR SLFFFSRLHPKLKGTVQFRTLIVNLVEVALGFNTTVVAMALCYGFGNNFFVRTGHMVLAV FVVYAIISIIYFLLIEAVFFQYVKVQFGYHLGAFFGLCGLIYPIVQYDTFLSNEYRTGIS WSFGMLFFIWAMFTTCRAVRYFRGRGSGSVKYQALATASGEEVAALSHHDSLESRRLREE EDDDDEDFEDA 371
84 Cytoplasmic envelopment protein 3 (28 kDa structural phosphoprotein) (pp28) F5HI87 MGAELCKRICCEFGTTSGEPLKDALGRQVSLRSYDNIPPTSSSDEGEDDDDGEDDDNEER QQKLRLCGSGCGGNDSSSGSHREATHDGPKKNAVRSTFREDKAPKPSKQSKKKKKPSKHH HHQQSSIMQETDDLDEEDTSIYLSPPPVPPVQVVAKRLPRPDTPRTPRQKKISQRPPTPG TKKPAASLPF 190
85 Alkaline nuclease, EC 3.1.-.- F5HF49 MWGVSSLDYDDDEELTRLLAVWDDEPLSLFLMNTFLLHQEGFRNLPFTVLRLSYAYRIFA KMLRAHGTPVAEDFMTRVAALARDEGLRDILGQRHAAEASRAEIAEALERVAERCDDRHG GSDDYVWLSRLLDLAPNYRQVELFQLLEKESRGQSRNSVWHLLRMDTVSATKFYEAFVSG CLPGAAAADGSGGGGSHYTGSRAGVSPGIQFGIKHEGLVKTLVECYVMHGREPVRDGLGL LIDPTSGLLGASMDLCFGVLKQGSGRTLLVEPCARVYEIKCRYKYLRKKEDPFVQNVLRR HDAAAVASLLQSHPVPGVEFRGERETPSAREFLLSHDAALFRATLKRARPLKPPEPLREY LADLLYLNKAECSEVIVFDAKHLNDDNSDGDATITINASLGLAAGDAAGGGADHHLRGSP GDSPPPIPFEDENTPELLGRLNVYEVARFSLPAFVNPRHQYYFQMLIQQYVLSQYYIKKH PDPERIDFRDLPTVYLVSAIFREREESELGCELLAGGRVFHCDHIPLLLIVTPVVFDPQF TRHAVSTVLDRWSRDLSRKTNLPIWVPNSANEYVVSSVPRPVSP 584
86 Serine/threonine protein kinase UL97, EC 2.7.11.1 Q6SW46 MSSALRSRARSASLGTTTQGWDPPPLRRPSRARRRQWMREAAQAAAQAAVQAAQAAAAQV AQAHVDEDEVVDLMTDEAGGGVTTLTTLSSVSTTTVLGHATFSACVRSDVMRDGEKEDAA SDKENQRRPVVPSTSSRGSAASGDGYHGLRCRETSAMWSFEYDRDGDVTSVRRALFTGGS DPSDSVSGVRGGRKRPLRPPLVSLARTPLCRRRVGGVDAVLEENDVELRAESQDSAVASG PGRVPQPLSGSSGEESATAVEADSTSHDDVHCTCSNDQIITTSIRGLTCDPRMFLRLTHP ELCELSISYLLVYVPKEDDFCHKICYAVDMSDESYRLGQGSFGEVWPLDRYRVVKVARKH SETVLTVWMSGLIRTRAAGEQQQPPSLVGTGVHRGLLTATGCCLLHNVTVHRRFHTDMFH HDQWKLACIDSYRRAFCTLADAIKFLNHQCRVCHFDITPMNVLIDVNPHNPSEIVRAALC DYSLSEPYPDYNERCVAVFQETGTARRIPNCSHRLRECYHPAFRPMPLQKLLICDPHARF PVAGLRRYCMSELSALGNVLGFCLMRLLDRRGLDEVRMGTEALLFKHAGAACRALENGKL THCSDACLLILAAQMSYGACLLGEHGAALVSHTLRFVEAKMSSCRVRAFRRFYHECSQTM LHEYVRKNVERLLATSDGLYLYNAFRRTTSIICEEDLDGDCRQLFPE 707
87 Protein UL96 F5H8R6 MTSVNKQLLKDVMRVDLERQQHQFLRRTYGPQHRLTTQQALTVMRVAAREQTRYSQRTTQ CVAAHLLEQRAAVQQELQRARQLQSGNVDDALDSLTELKDTVDDVRATLVDSVSATCDLD LEVDDAV 127
88 Protein UL95 Q6SW48 MMAAAVVRAEVRRQRREERKKMASARTTEDPPENHVVADVACGTGAVTRSSSSSLVVSSS SASGSDESSSASPLSFPVSSPSTAVRSPGSAGVSTSLCSVERMVELSAQSPAADFSVSEA WRFEEAVNMALVACEAVSPYDRFRLIETPDENFLLVTNVIPRESAEVPVLDSSSSGGDSG PEDKKKNVGNKTAGEKNGGGSRAKRRRRRRAPKNDAATPSFLRRHDVLERFAAAAEPLPS LCVHDYALRNADRVTYDGELIYGSYLLYRKAHVELSLSSNKVQHVEAVLRQVYTPGLLDH HNVCDVEALLWLLYCGPRSFCARDTCFGREKNGCPFPALLPKLFYEPVRDYMTYMNLAEL YVFVWYRGYEFPAPTPQATTAGGGGGGGSGGGGGAGACAVETSASAGRVDDAGDEVHLPL KPVSLDRLREVLQAVRGRFSGREVPAWPASSRTCLLCALYSQNRLCLDLARDEARTVSYS PIVIQDCAAAVTDVTLSHILPGQSTVSLFPVYHVGKLLDALSLNDAGLITLNL 533
89 Cytoplasmic envelopment protein 2 F5HAC7 MAWRSGLCETDSRTLKQFLQEECMWKLVGKSRKHREYRAVACRSTIFSPEDDGSCILCQL LLFYRDGEWILCLCCNGRYQGHYGVGHVHRRRRRICHLPTLYQLSFGGPLGPASIDFLPS FSQVTSSMTCDGITPDVIYEVCMLVPQDEAKRILVKGHGAMDLTCQKAVTLGGAGAWLLP RPEGYTLFFYILCYDLFTSCGNRCDIPSMTRLMAAATACGQAGCSFCTDHEGHVDPTGNY VGCTPDMGRCLCYVPCGPMTQSLIHNEEPATFFCESDDAKYLCAVGSKTAAQVTLGDGLD YHIGVKDSEGRWLPVKTDVWDLVKVEEPVSRMIVCSCPVLKNLVH 345
90 Capsid vertex component 1 Q6SW50 METHLYSDLAFEARFADDEQLPLHLVLDQEVLSNEEAETLRYVYYRNVDSAGRSAGRVPS GDEDDAPASDDAEDAVGGDRAFDRERRTWQRACFRVLPRPLELLDYLRQSGLTVTLEKEQ RVRMFYAVFTTLGLRCPDNRLSGAQTLHLRLVWPDGSYRDWEFLARDLLREEMEANKRDR QHQLATTTNHRRRGGLRNNLDNGSDRRLPEAAVASLETAVSTPFFEIPNGAGTSSANGGG RFSNLEQRVARLLRGDEEFIYHAGPLEPPSKIRGHELVQLRLDVNPDLMYATDPHDRDEV ARTDEWKGAGVSRLREVWDVQHRVRLRVLWYVNSFWRSRELSYDDHEVELYRALDAYRAR IAVEYVLIRAVRDEIYAVLRRDSGALPQRFACHVPRNMSWRVVWELCRHALALWMDRADV RSCIIKALTPRLSRGAAAAAQRARRQRERSAPKPQELLFGPRNESGPPAERTWYADVVRC VRTQVDLGVEVRAARCPRTGLWIVRDRRGRLRRWLSQPEVCVLYVTPDLDFYWVLPGGFA VSSRVTLHGLAQRALRDRFQNFEAVLARGMHVEAGRQEPETPRVSGRRLPFDDL 594
91 Uncharacterized protein UL92 F5HAS7 METHLYSDLAFEARFADDEQLPLHLVLDQEVLSNEEAETLRYVYYRNVDSAGRSAGRVPS GDEDDAPASDDAEDAVGGDRAFDRERRTWQRACFRVLPRPLELLDYLRQSGLTVTLEKEQ RVRMFYAVFTTLGLRCPDNRLSGAQTLHLRLVWPDGSYRDWEFLARDLLREEMEANKRDR QHQLATTTNHRRRGGLRNNLDNGSDRRLPEAAVASLETAVSTPFFEIPNGAGTSSANGGG RFSNLEQRVARLLRGDEEFIYHAGPLEPPSKIRGHELVQLRLDVNPDLMYATDPHDRDEV ARTDEWKGAGVSRLREVWDVQHRVRLRVLWYVNSFWRSRELSYDDHEVELYRALDAYRAR IAVEYVLIRAVRDEIYAVLRRDSGALPQRFACHVPRNMSWRVVWELCRHALALWMDRADV RSCIIKALTPRLSRGAAAAAQRARRQRERSAPKPQELLFGPRNESGPPAERTWYADVVRC VRTQVDLGVEVRAARCPRTGLWIVRDRRGRLRRWLSQPEVCVLYVTPDLDFYWVLPGGFA VSSRVTLHGLAQRALRDRFQNFEAVLARGMHVEAGRQEPETPRVSGRRLPFDDL 201
92 Protein UL91 F5HFJ8 MNSLLAELNRLGVAHATTEDVFIFVDRLFQHFSFLFQAEESGPRRLELVASVFEHLTVEC VNDILDACSHPDVNVVETSNTCRPCPSPVPSAPKTVSDAQTSCATPRAPVT 111
93 Tripartite terminase subunit 3, EC 3.1.-.- (Terminase large subunit) V9LM18 MLRGDSAAKIQERYAELQKRKSHPTSCISTAFTNVAALCRKRYQMMHPELGLAHSCNEAF LPLMAFCGRHRDYNSPEESQRELLFHERLKSALDELTFRPCSEEQRASYQKLDALTELYR DPQFQQINNFMTDFKKWLDGGFSTAVEGDAKAIRLEPFQKNLLIHVIFFIAVTKIPVLAN RVLQYLIHAFQIDFLSQTSIDIFKQKATVFLVPRRHGKTWFIIPIISFLLKHMIGISIGY VAHQKHVSQFVLKEVEFRCRHTFARDYVVENKDNVISIDHRGAKSTALFASCYNTNSIRG QNFHLLLVDEAHFIKKEAFNTILGFLAQNTTKIIFISSTNTTSDATCFLTRLNNAPFDML NVVSYVCEEHLHSFTEKGDATACPCYRLHKPTFISLNSQVRKTANMFMPGAFMDEIIGGT NKISQNTVLITDQSREEFDILRYSTLNTNAYDYFGKTLYVYLDPAFTTNRKASGTGVAAV GAYRHQFLIYGLEHFFLRDLSESSEVAIAECAAHMIISVLSLHPYLDELRIAVEGNTNQA AAVRIACLIRQSVQSSTLIRVLFYHTPDQNHIEQPFYLMGRDKALAVEQFISRFNSGYIK ASQELVSYTIKLSHDPIEYLLEQIQNLHRVTLAEGTTARYSAKRQNRISDDLIIAVIMAT YLCDDIHAIRFRVS 674
94 Protein UL88 F5H9F9 MMEAAAAAAAAFRPEERPTPGWHDAALLMDDGTVREHAFRNGPLSQLIRRVLPPPPDAED DVVFASELCFYCSGRFNRRSSVFSIYWQKHSDLVYALTGITHCAKLVVECGQLGSSRLRW RDGDASGEERRGDDDSRDELYDVPGIYMIRVNDGGSTGPRHVIWPGTSVLWAPDVVITTV QRRISAARALVNTFRQYFFLLERRSHEELVLCPPEMEERLAPLLQSATRGDSDMFDGVVA SAYHRLRMSNIPRSSARLLEHCVGLAGAKKLLLLDVPRLENYFLCQVCLYELDEDEMGEE MLGMLAGKPEDAAVSGASGGFLLHRKTMKLAACLCLLLNSLHLHQEALEALDPPPPRVEE NDLVNVVLRRYYRSHGGVQARTLAAARALLADYAETFSPLGSFTRLGYDRLVSADAGVSR RHLVALLRA 429
95 Uncharacterized protein UL87 Q6SW55 MAGAAPRRLGCDALIVVGGSAMPRRVLHVPVHVRACNLTQELSTGEDARFCRPRPVNVER VRAVFAALYRACPIHVRTEPERVKLVLGRLLLGPVAVPCFCDGEVEGHGEHLVPTTQFCR GPLLYVHRRCCCGSVTAGRALSYHVLENHVATHVLRGLLSLTEWNRELPSLFCDCPGGGG ASGTEERYAMACLPRDLSLHLDDYPYLMVEIGRVLSVSEVDDYVTAVSGYLGEAAAPRIQ VHYKLLFGLNVRPQAPCALDATRDFFLLELQKLWLGVEYHHEVTSEFFGRVLAQLHRDRA RVMMALRLPEQTVCHLSTFVLSRFKRQVLYFKLQVSYGKCRTGHADRSGGGGNGGNQGHH NLLCYRRLSVTFADTDTVWRNLFYVYYELARDLGSHGTENRPVNRGYGVSCAPRTSRLSP SESTVVSANGHALSSTALPTTSAGHKLSLPRDPAADRVRRYVCIISRLMYARYGERWRKH RQRRSETGEEEEEETLESGETDATPPFDFTGQQLRRAYQEHRRRKHLAVQRYAPCRRKLI GGMEFAEVTGVSLDRIAVNAFNTNRVINMKAALSSIAASGLGVRAPRLPKNMTHSFVMYK HTFKEPACTVSTFVSNDAVYINSLNVNIRGSYPEFLYSLGVYRLHVNIDHFFLPAVVCNS NSSLDVHGLEDQAVIRSERSKVYWTTNFPCMISHTNNVNVGWFKAATAIVPRVSGADLEA ILLKELSCIKNMRDVCIDYGLHRVFTQLELRNSYQIPFLAKQLVLFLRACLLKLHGREKR LQLDRLVFEAAQRGLFDYSKNLTAHTKIKHTCALIGSRLANNVPKILARNKKVKLDHLGR NANVLTVCRHVEAHKIPRTRLKVLVEVLGVLQSISGTPHTREVIHQTLFRLCSAAAATSG LCSSPPPLCVSSSSSVPSVPTSVSVDGSSEPTSPRVRFASR 941
96 Major capsid protein, MCP F5HGT1 MENWSALELLPKVGIPTDFLTHVKTSAGEEMFEALRIYYGDDPERYNIHFEAIFGTFCNR LEWVYFLTSGLAAAAHAIKFHDLNKLTTGKMLFHVQVPRVASGAGLPTSRQTTIMVTKYS EKSPITIPFELSAACLTYLRETFEGTILDKILNVEAMHTVLRALKNTADAMERGLIHSFL QTLLRKAPPYFVVQTLVENATLARQALNRIQRSNILQSFKAKMLATLFLLNRTRDRDYVL KFLTRLAEAATDSILDNPTTYTTSSGAKISGVMVSTANVMQIIMSLLSSHITKETVSAPA TYGNFVLSPENAVTAISYHSILADFNSYKAHLTSGQPHLPNDSLSQAGAHSLTPLSMDVI RLGEKTVIMENLRRVYKNTDTKDPLERNVDLTFFFPVGLYLPEDRGYTTVESKVKLNDTV RNALPTTAYLLNRDRAVQKIDFVDALKTLCHPVLHEPAPCLQTFTERGPPSEPAMQRLLE CRFQQEPMGGAARRIPHFYRVRREVPRTVNEMKQDFVVTDFYKVGNITLYTELHPFFDFT HCQENSETVALCTPRIVIGNLPDGLAPGPFHELRTWEIMEHMRLRPPPDYEETLRLFKTT VTSPNYPELCYLVDVLVHGNVDAFLLIRTFVARCIVNMFHTRQLLVFAHSYALVTLIAEH LADGALPPQLLFHYRNLVAVLRLVTRISALPGLNNGQLAEEPLSAYVNALHDHRLWPPFV THLPRNMEGVQVVADRQPLNPANIEARHHGVSDVPRLGAMDADEPLFVDDYRATDDEWTL QKVFYLCLMPAMTNNRACGLGLNLKTLLVDLFYRPAFLLMPAATAVSTSGTTSKESTSGV TPEDSIAAQRQAVGEMLTELVEDVATDAHTPLLQACRELFLAVQFVGEHVKVLEVRAPLD HAQRQGLPDFISRQHVLYNGCCVVTAPKTLIEYSLPVPFHRFYSNPTICAALSDDIKRYV TEFPHYHRHDGGFPLPTAFAHEYHNWLRSPFSRYSATCPNVLHSVMTLAAMLYKISPVSL VLQTKAHIHPGFALTAVRTDTFEVDMLLYSGKSCTSVIINNPIVTKEERDISTTYHVTQN INTVDMGLGYTSNTCVAYVNRVRTDMGVRVQDLFRVFPMNVYRHDEVDRWIRHAAGVERP QLLDTETISMLTFGSMSERNAAATVHGQKAACELILTPVTMDVNYFKIPNNPRGRASCML AVDPYDTEAATKAIYDHREADAQTFAATHNPWASQAGCLSDVLYNTRHRERLGYNSKFYS PCAQYFNTEEIIAANKTLFKTIDEYLLRAKDCIRGDTDTQYVCVEGTEQLIENPCRLTQE ALPILSTTTLALMETKLKGGAGAFATSETHFGNYVVGEIIPLQQSMLFNS 1,370
97 Protein UL84 F5HB40 MPRVDPNLRNRARRPRARRGGGGGVGSNSSRHSGKCRRQRRALSTPPLTFLATTTTTTMM GVASTDDDSLLLKTPDELDKHSGSPQTILTLTDKHDIRQPRVHRGTYHLIQLHLDLRPEE LRDPFQILLSTPLQLGEANGESQTAPATSQEEETAASHEPEKKKEKEEKKEEEDEDDRND DRERGILCVVSNEDSDVRPAFSLFPARPGCHILRSVIDQQLTRMAIVRLSLNLFALRIIT PLLKRLPLRRKAAHHTALHDCLALHLPELTFEPTLDINNVTENAASVADTAESTDADLTP TLTVRVRHALCWHRVEGGISGPRGLTSRISARLSETTAKTLGPSVFGRLELDPNESPPDL TLSSLTLYQDGILRFNVTCDRTEAPADPVAFRLRLRRETVRRPFFSDAPLPYFVPPRSGA ADEGLEVRVPYELTLKNSHTLRIYRRFYGPYLGVFVPHNRQGLKMPVTVWLPRSWLELTV LVSDENGATFPRDALLGRLYFISSKHTLNRGCLSAMTHQVKSTLHSRSTSHSPSQQQLSV LGASIALEDLLPMRLASPETEPQDCKLTENTTEKTSPVTLAMVCGDL 587
98 65 kDa phosphoprotein, pp65 (65 kDa matrix phosphoprotein) (Phosphoprotein UL83) (Tegument protein UL83) Q6SW59 MESRGRRCPEMISVLGPISGHVLKAVFSRGDTPVLPHETRLLQTGIHVRVSQPSLILVSQ YTPDSTPCHRGDNQLQVQHTYFTGSEVENVSVNVHNPTGRSICPSQEPMSIYVYALPLKM LNIPSINVHHYPSAAERKHRHLPVADAVIHASGKQMWQARLTVSGLAWTRQQNQWKEPDV YYTSAFVFPTKDVALRHVVCAHELVCSMENTRATKMQVIGDQYVKVYLESFCEDVPSGKL FMHVTLGSDVEEDLTMTRNPQPFMRPHERNGFTVLCPKNMIIKPGKISHIMLDVAFTSHE HFGLLCPKSIPGLSISGNLLMNGQQIFLEVQAIRETVELRQYDPVAALFFFDIDLLLQRG PQYSEHPTFTSQYRIQGKLEYRHTWDRHDEGAAQGDDDVWTSGSDSDEELVTTERKTPRV TGGGAMASASTSAGRKRKSASSATACTAGVMTRGRLKAESTVAPEEDTDEDSDNEIHNPA VFTWPPWQAGILARNLVPMVATVQGQNLKYQEFFWDANDIYRIFAELEGVWQPAAQPKRR RHRQDALPGPCIASTPKKHRG 561
99 Protein pp71 F5HBC6 MSQASSSPGEGPSSEAAAISEAEAASGSFGRLHCQVLRLITNVEGGSLEAGRLRLLDLRT NIEVSRPSVLCCFQENKSPHDTVDLTDLNIKGRCVVGEQDRLLVDLNNFGPRRLTPGSEN NTVSVLAFALPLDRVPVSGLHLFQSQRRGGEENRPRMEARAIIRRTAHHWAVRLTVTPNW RRRTDSSLEAGQIFVSQFAFRAGAIPLTLVDALEQLACSDPNTYIHKTETDERGQWIMLF LHHDSPHPPTSVFLHFSVYTHRAEVVARHNPYPHLRRLPDNGFQLLIPKSFTLTRIHPEY IVQIQNAFETNQTHDTIFFPENIPGVSIEAGPLPDRVRITLRVTLTGDQAVHLEHRQPLG RIHFFRRGFWTLTPGKPDKIKRPQVQLRAGLFPRSNVMRGAVSEFLPQSPGLPPTEEEEE EEEEDDEDDLSSTPTPTPLSEAMFAGFEEASGDEDSDTQAGLSRALILTGQRRRSGNNGA LTLVIPSWHVFASLDDLVPLTVSVQHAALRPTSYLRSDMDGDVRTAADISSTLRSVPAPR PSPISTASTSSTPRSRPRI 559
100 Capsid scaffolding protein (Capsid protein P40) (Protease precursor, pPR) [Cleaved into: Assemblin, EC 3.4.21.97 (Protease) ; Assembly protein (Capsid assembly protein) ] Q6SW62 MTMDEQQSQAVAPVYVGGFLARYDQSPDEAELLLPRDVVEHWLHAQGQGQPSLSVALPLN INHDDTAVVGHVAAMQSVRDGLFCLGCVTSPRFLEIVRRASEKSELVSRGPVSPLQPDKV VEFLSGSYAGLSLSSRRCDDVEAATSLSGSETTPFKHVALCSVGRRRGTLAVYGRDPEWV TQRFPDLTAADRDGLRAQWQRCGSTAVDASGDPFRSDSYGLLGNSVDALYIRERLPKLRY DKQLVGVTERESYVKASVSPEAACVIKAASAERSGDSRSQAATPAAGARVPSSSPSPPVE PPSPVQPPALPASPSVLPAESPPSLSPSEPAEAASMSHPLSAAVPAATAPPGATVAGASP AVSSLAWPHDGVYLPKDAFFSLLGASRSAAPVMYPGAVAAPPSASPAPLPLPSYPASYGA PVVGYDQLAARHFADYVDPHYPGWGRRYEPAPSLHPSYPVPPPPSPAYYRRRDSPGGMDE PPSGWERYDGGHRGQSQKQHRHGGSGGHNKRRKETAAASSSSSDEDLSFPGEAEHGRARK RLKSHVNSDGGSGGHAGSNQQQQQRYDELRDAIHELKRDLFAARQSSTLLSAALPSAASS SPTTTTVCTPTSELTSGGGETPTALLSGGAKVAERAQAGVVNASCRLATASGSEAATAGP STAGSSSCPASVVLAAAAAQAAAASQSPPKDMVDLNRRIFVAALNKLE 708
101 Capsid scaffolding protein (Capsid protein P40) (Protease precursor, pPR) [Cleaved into: Assemblin, EC 3.4.21.97 (Protease) ; Assembly protein (Capsid assembly protein) ] Q6SW62 MTMDEQQSQAVAPVYVGGFLARYDQSPDEAELLLPRDVVEHWLHAQGQGQPSLSVALPLN INHDDTAVVGHVAAMQSVRDGLFCLGCVTSPRFLEIVRRASEKSELVSRGPVSPLQPDKV VEFLSGSYAGLSLSSRRCDDVEAATSLSGSETTPFKHVALCSVGRRRGTLAVYGRDPEWV TQRFPDLTAADRDGLRAQWQRCGSTAVDASGDPFRSDSYGLLGNSVDALYIRERLPKLRY DKQLVGVTERESYVKASVSPEAACVIKAASAERSGDSRSQAATPAAGARVPSSSPSPPVE PPSPVQPPALPASPSVLPAESPPSLSPSEPAEAASMSHPLSAAVPAATAPPGATVAGASP AVSSLAWPHDGVYLPKDAFFSLLGASRSAAPVMYPGAVAAPPSASPAPLPLPSYPASYGA PVVGYDQLAARHFADYVDPHYPGWGRRYEPAPSLHPSYPVPPPPSPAYYRRRDSPGGMDE PPSGWERYDGGHRGQSQKQHRHGGSGGHNKRRKETAAASSSSSDEDLSFPGEAEHGRARK RLKSHVNSDGGSGGHAGSNQQQQQRYDELRDAIHELKRDLFAARQSSTLLSAALPSAASS SPTTTTVCTPTSELTSGGGETPTALLSGGAKVAERAQAGVVNASCRLATASGSEAATAGP STAGSSSCPASVVLAAAAAQAAAASQSPPKDMVDLNRRIFVAALNKLE 708
102 Protein UL79 Q6SW63 MMARDEENPAVPRVRTGKFSFTCANHLILQISEKMSRGQPLSSLRLEELKIVRLICVLLF HRGLETLLLRETMNNLGVSDHAVLSRKTPQPYWPHLYRELRQAFPGLDFEAAVFDETRAA RLSQRLCHPRLSGGLLTRFVQRHTGLPVVFPEDLARNGNILFSLGTLYGHRLFRLAAFFT RHWGAEAYEPLIRIICQKMWYFYLIGTGKMRITPDAFDIQRSRHETGIFTFIMEDYRTFA GTLSRHPHRPHPQQQQHHHPGPPHPPLSHPASSCLSPEAVLAARALHMPTLANDV 295
103 Protein UL78 F5HET1 MSPSVEETTSVTESIMFAIVSFKHMGPFEGYSMSADRAASDLLIGMFGSVSLVNLLTIIG CLWVLRVTRPPVSVMIFTWNLVLSQFFSILATMLSKGIMLRGALNLSLCRLVLFVDDVGL YSTALFFLFLILDRLSAISYGRDLWHHETRENAGVALYAVAFAWVLSIVAAVPTAATGSL DYRWLGCQIPIQYAAVDLTIKMWFLLGAPMIAVLANVVELAYSDRRDHVWSYVGRVCTFY VTCLMLFVPYYCFRVLRGVLQPASAAGTGFGIMDYVELATRTLLTMRLGILPLFIIAFFS REPTKDLDDSFDYLVERCQQSCHGHFVRRLVQALKRAMYSVELAVCYFSTSVRDVAEAVK KSSSRCYADATSAAVVVTTTTSEKATLVEHAEGMASEMCPGTTIDVSAESSSVLCTDGEN TVASDATVTAL 431
104 Capsid vertex component 2 Q6SW65 MSLLHTFWRLPVAVFFEPHEENVLRCPERVLRRLLEDAAVAMRGGGWREDVLMDRVRKRY LRQELRDLGHRVQTYCEDLEGRVSEAEALLNQQCELDEGPSPRTLLQPPCRPRSSSPGTG VAGASAVPHGLYSRHDAITGPVAAPSDAVAASAAAGASSTWLAQCAEQPLPGNVPNYFGI TQNDPFIRFHTDFRGEVVNTMFENASTWTFSFGIWYYRLKRGLYTQPRWKRVYHLAQMDN FSISQELLLGVVNALENVTVYPTYDCVLSDLEAAACLLVAYGHALWEGRDPPDSVTAVLS ELPQLLPRLADDVSREIAAWEGPVAAGNNYYAYRDSPDLRYYMPLSGGRHYHPGTFDRHV LVRLFHKRGVLQHLPGYGTITEELVQERLSGQVRDDVLSLWSRRLLVGKLGRDVPVFVHE QQYLRSGLTCLAGLLLLWKVTNADSVFAPRTGKFTLADLLGSDAVAGGGLPGGRAGGEEK GYGGRHGRVRNFEFLVQYYIGPWYARDPAVTLSQLFPGLALLAVTESVRSGWDPSRREDS AGGGDGGGAVLMQLSKSNPVADYMFAQSSKQYGDLRRLEVHDALLFHYEHGLGRLLSVTL PRHRVSTLGSSLFNVNDIYELLYFLVLGFLPSVAVL 636
105 Protein UL76 Q6SW66 MPSGCGDDADSTGNALRRLPHVRKRIGKRKHLDIYRRLLRVFPSFVALNRLLGGLFPPEL QKYRRRLFIEVRLSRRIPDCVLVFLPPDSGSRGIVYCYVIEFKTTYSDADDQSVRWHATH SLQYAEGLRQLKGALVDFDFLRLPRGGGQVWSVVPSLVFFQQKADRPSFYRAFRSGRFDL CTDSVLDYLGRRQDESVAHLLAATRRRLLRAARGKRAALPRARASAVAGGRGGGNARRGL ARGRAHGPGAQTVSASGAEGSGSQGTDLLRGSRRARVRGGGAVEPAVRARRRTVAADAAT TTVSSAFVVPRDRRGRSFRRPTRSL 325
106 Envelope glycoprotein H, gH Q6SW67 MRPGLPSYLIILAVCLFSHLLSSRYGAEAVSEPLDKAFHLLLNTYGRPIRFLRENTTQCT YNSSLRNSTVVRENAISFNFFQSYNQYYVFHMPRCLFAGPLAEQFLNQVDLTETLERYQQ RLNTYALVSKDLASYRSFSQQLKAQDSLGEQPTTVPPPIDLSIPHVWMPPQTTPHGWTES HTTSGLHRPHFNQTCILFDGHDLLFSTVTPCLHQGFYLIDELRYVKITLTEDFFVVTVSI DDDTPMLLIFGHLPRVLFKAPYQRDNFILRQTEKHELLVLVKKDQLNRHSYLKDPDFLDA ALDFNYLDLSALLRNSFHRYAVDVLKSGRCQMLDRRTVEMAFAYALALFAAARQEEAGAQ VSVPRALDRQAALLQIQEFMITCLSQTPPRTTLLLYPTAVDLAKRALWTPNQITDITSLV RLVYILSKQNQQHLIPQWALRQIADFALKLHKTHLASFLSAFARQELYLMGSLVHSMLVH TTERREIFIVETGLCSLAELSHFTQLLAHPHHEYLSDLYTPCSSSGRRDHSLERLTRLFP DATVPATVPAALSILSTMQPSTLETFPDLFCLPLGESFSALTVSEHVSYIVTNQYLIKGI SYPVSTTVVGQSLIITQTDSQTKCELTRNMHTTHSITVALNISLENCAFCQSALLEYDDT QGVINIMYMHDSDDVLFALDPYNEVVVSSPRTHYLMLLKNGTVLEVTDVVVDATDSRLLM MSVYALSAIIGIYLLYRMLKTC 742
107 Envelope glycoprotein O F5HGP1 MGKKEMIMVKGIPKIMLLISITFLLLSLINCNVLVNSRGTRRSWPYTVLSYRGKEILKKQ KEDILKRLMSTSSDGYRFLMYPSQQKFHAIVISMDKFPQDYILAGPIRNDSITHMWFDFY STQLRKPAKYVYSEYNHTAHKITLRPPPCGTVPSMNCLSEMLNVSKRNDTGEKGCGNFTT FNPMFFNVPRWNTKLYIGSNKVNVDSQTIYFLGLTALLLRYAQRNCTRSFYLVNAMSRNL FRVPKYINGTKLKNTMRKLKRKQALVKEQPQKKNKKSQSTTTPYLSYTTSTAFNVTTNVT YSATAAVTRVATSTTGYRPDSNFMKSIMATQLRDLATWVYTTLRYRNEPFCKPDRNRTAV SEFMKNTHVLIRNETPYTIYGTLDMSSLYYNETMSVENETASDNNETTPTSPSTRFQRTF IDPLWDYLDSLLFLDKIRNFSLQLPAYGNLTPPEHRRAANLSTLNSLWWWSQ 472
108 Deoxyuridine 5'-triphosphate nucleotidohydrolase, dUTPase, EC 3.6.1.23 (dUTP pyrophosphatase) Q6SW70 MLTMLTDRIDSQLVLSRLPRSRFQRFWETPTLIMKEESAPSSGSIILAEKSVNMRYCVRF ASDSDFQTTFTLPQSTEEKYDKEQHPGEDEASSPLPSPLKVPYKWMPSSFIVKQCHTQLA FYNKHIIWLSRERKVPTSLGVSLYIPEGFFGITFYKCLDAQFVCMPELLESGLQVPQLDV VNLNDTFQSIFPGTIEGDIGVFPCFVPEPWQLMNLPPPNEHRFFSLRTRQTLVIGPGHTQ TVYFDAAYVHAPGICALIVGVRQFSQSDLIIRPTIWLPGTAAGVTVVNTSHTTVCISPHT TVAKAVFTTHRFTYLPVGSHPLGQMIVPPTPDIGFTHTPEHALLQRTPSPVDDDVDETEE DEKSSDAESPVNTSDVIFDVGPKPPRHP 388
109 DNA primase, EC 2.7.7.- F5HG51 MTLVLFATEYDSAHIVANVLSQTPTDHCVFPLLVKHQVSRRVYFCLQTQKCSDSRRVAPV FAVNNETLQLSRYLAARQPIPLSALIASLDEAETRPLYRHLFRTPVLSPEHGGEVREFKH LVYFHHAAVLRHLNQVFLCPTSPSWFISVFGHTEGQVLLTMAYYLFEGQYSTISTVEEYV RSFCTRDLGTIIPTHASMGEFARLLLGSPFRQRVSAFVAYAVARNRRDYTELEQVDTQIN AFRERARLPDTVCVHYVYLAYRTALARARLLEYRRVVAYDADAAPEAQCTREPGFLGRRL STELLDVMQKYFSLDNFLHDYVETHLLRLDESPHSATSPHGLGLAGYGGRIDGTHLAGFF GTSTQLARQLERINTLSESVFSPLERSLSGLLRLCASLRTAQTYTTGTLTRYSQRRYLLP EPALAPLLERPLPVYRVHLPNDQHVFCAVASETWHRSLFPRDLLRHVPDSRFSDEALTET VWLHDDDVASTSPETQFYYTRHEVFNERLPVFNFVADFDLRLRDGVSGLARHTVFELCRG LRRVWMTVWASLFGYTHPDRHPVYFFKSACPPNSVPVDAAGAPFDDDDYLDYRDERDTEE DEDGKEDKNNVPGNGVFQKTTSSVDTSPPYCRCKGKLGLRIITPFPACTIAVHPSVLRAV AQVLNHAVCLDAELHTLLDPISHPESSLDTGIYHHGRSVRLPYMYKMDQDDGYFMHRRLL PLFIVPDAYREHPLGFVRAQLDLRNLLHHHPPHDLPALPLSPPPRVILSVRDKICPSTEA NFIETRSLNVTRYRRRGLTEVLAYHLYGGDGATAAAISDTDLQRLVVTRVWPPLLEHLTQ HYEPHVSEQFTAPHVLLFQPHGACCVAVKRRDGARTRDFRCLNYTHRNPQETVQVFIDLR TEHSYALWASLWSRCFTKKCHSNAKNVHISIKIRPPDAPMPPATAV 946
110 mRNA export factor ICP27 homolog Q6SW73 MELHSRGRHDAPSLSSLSERERRARRARRFCLDYEPVPRKFRRERSPTSPSTRNGAAASE YHLAEDTVGAASHHHRPCVPARRPRYSKDDDTEGDPDHYPPPLPPSSRHALGGTGGHIIM GTAGFRGGHRASSSFKRRVAASASVPLNPHYGKSYDNDDGEPHHHGGDSTHLRRRVPSCP TTFGSSHPSSANNHHGSSAGPQQQQMLALIDDELDAMDEDELQQLSRLIEKKKRARLQRG AASSGTSPSSTSPVYDLQRYTAESLRLAPYPADLKVPTAFPQDHQPRGRILLSHDELMHT DYLLHIRQQFDWLEEPLLRKLVVEKIFAVYNAPNLHTLLAIIDETLSYMKYHHLHGLPVN PHDPYLETVGGMRQLLFNKLNNLDLGCILDHQDGWGDHCSTLKRLVKKPGQMSAWLRDDV CDLQKRPPETFSQPMHRAMAYVCSFSRVAVSLRRRALQVTGTPQFFDQFDTNNAMGTYRC GAVSDLILGALQCHECQNEMCELRIQRALAPYRFMIAYCPFDEQSLLDLTVFAGTTTTTA SNHATAGGQQRGGDQIHPTDEQCASMESRTDPATLTAYDKKDREGSHRHPSPMIAAAAPP AQPPSQPQQHYSEGELEEDEDSDDASSQDLVRATDRHGDTVVYKTTAVPPSPPAPLAGVR SHRGELNLMTPSPSHGGSPPQVPHKQPIIPVQSANGNHSTTATQQQQPPPPPPVPQEDDS VVMRCQTPDYEDMLCYSDDMDD 742
111 Major DNA-binding protein F5HDQ6 MSHEELTALAPVGPAAFLYFSRLNAETQEILATLSLCDRSSSVVIAPLLAGLTVEADFGV SVRTPVLCYDGGVLTKVTSFCPFALYFHHTQGIVAFTEDHGDVHRLCEDARQKYALEAYT PEADRVPTDLAALCAAVGCQASETTVHVVVGNGLKEFLFAGQLIPCVEEATTVRLHGGEA VRVPLYPPTLFNSLQLDAEADEVSLDARSAFVEARGLYVPAVSETLFYYVYTSWCQSLRF SEPRVLIEAALRQFVHDSQQSVKLAPHKRYLGYMSQRLSSLEKDHLMLSDAVVCELAFSF ASVFFDSAYQPAESMLFSEWPLVTNATDHRDLIRALTELKLHLSTHVAALVFSANSVLYQ HRLVYLQSSARHPSAGGTASQETLLKAIQFTNGLSAACEDVYNDARKVLKFQGAPLKDER YGPQHLALVCGTCPQLVSGFVWYLNRVSVYNTGLSGSSTLTNHLVGCAAGLCEACGGTCC HTCYQTAFVRVRTRLPVVPKQPKKEPCVITVQSRFLNDVDILGSFGRRYNVDAKDGGLDG KGDDGVPGGGAGGGGGRDVSGGPSDGLGGGRGGGGGGDSGGMMGRGGRMLGASVDRTYRL NRILDYCRKMRLIDPVTGEDTFSAHGKSDFVAVFSALNKFVDDEALGFVSEVRLKSSRDE VAGATQAFNLDLNPYAVAFQPLLAYAYFRSVFYVIQNVALITATSYIVDNPLTTNLVSKW MTQHFQSIHGAFSTTSSRKGFLFTKQIKSSKNSDHDRLLDFRLYAQGTYAVVPMEIKLSR LSVPTLIMVRVKNRPIYRAGKGNAGSVFFRRDHVPRRNPAKGCLGFLLYRHHERLFPECG LPCLQFWQKVCSNALPKNVPIGDMGEFNAFVKFLVAVTADYQEHDLLDVAPDCVLSYVES RFHNKFLCYYGFKDYIGSLHGLTTRLTTQNHAQFPHVLGASPRFSSPAEFALHVKGLKTA GVPAPMAATVARESLVRSVFEHRSLVTVPVSVEKYAGINNSKEIYQFGQIGYFSGNGVER SLNVSSMSGQDYRFMRQRYLLATRLADVLIKRSRRENVLFDADLIKNRVMLALDAENLDC DPEVMAVYEILSVREEIPASDDVLFFVDGCEALAASLMDKFAALQEQGVEDFSLENLRRV LDADAQRLTDAAGGEVHDLSALFAPSGVGAASGVGGGGLLLGESVAGNSICFGVPGETGG GCFLVNAGEDEAGGVGGSSGGGGGSGLLPAKRSRL 1,235
112 Tripartite terminase subunit 1 F5HC79 MEMNLLQKLCVVCSKCNEYAMELECLKYCDPNVLLAESTPFKRNAAAIVYLYRKIYPEVV AQNRTQSSLLTLYLEMLLKALHEDTALLDRALMAYSRQPDRAAFYRTVLRLDRCDRHHTV ELQFTDNVRFSVSLATLNDIERFLCKMNYVYGILAPEAGLEVCAQLLELLRRLCGISPVA RQEVYVEGTTCAQCYEELTIIPNQGRSLNKRLQGLLCNHIAVHRPSSQSDVNIQTVEQDL LDLTTRIPHLAGVLSALKSLFSSSSAYHSYIQEAEEALREYNLFTDIPERIYSLSDFTYW SRTSEVIVKRVGITIQQLNVYHQLCRALMNGISRHLYGEDVEDIFVLGEKALDGEERMFV GSVFAAPNRIIDLITSLSIQAFEDNPVFNKLHESNEMYTKIKHILEEIRRPLPDGTGGDG PEGEVIHLRGREAMSGTGTTLMTASNSSNSSTHSQRNNGGGGRARGGGKKAVGGGANGQD GDGSENGLRVRNCDEHEALDLVDARSRIHNVTREVNVRKRAYLQKVSEVGYGKVIRCIKT QERLTSKLIDVNLVGPLCLDFISKLMNGFLYRSQYHQDQDVVDVGNQFTYDEHLYVVNNL IHKSLPVESLPLLGQQIYELCNGPLFTHCTDRYPLSHNVDMAYACDNAGVLPHVKDDLVK CAEGTVYPSEWMVVKYMGFFNFSDCQDLNVLQKEMWMHVRELVLSVALYNETFGKQLSIA CLRDELHPDRDVILTYNKEWPLLLRHEGSLYKSKDLYLLLYRHLSRPDESGDVPTAPVAK PSTLTAAAAVSGAFREPDRPWLPSPYPSSSTAGVSRRVRATRKRPRRASSLLDLARDEHG IQDLVPGSLR 850
113 Envelope glycoprotein B, gB F5HB53 MESRIWCLVVCVNLCIVCLGAAVSSSSTRGTSATHSHHSSHTTSAAHSRSGSVSQRVTSS QTVSHGVNETIYNTTLKYGDVVGVNTTKYPYRVCSMAQGTDLIRFERNIVCTSMKPINED LDEGIMVVYKRNIVAHTFKVRVYQKVLTFRRSYAYIHTTYLLGSNTEYVAPPMWEIHHIN SHSQCYSSYSRVIAGTVFVAYHRDSYENKTMQLMPDDYSNTHSTRYVTVKDQWHSRGSTW LYRETCNLNCMVTITTARSKYPYHFFATSTGDVVDISPFYNGTNRNASYFGENADKFFIF PNYTIVSDFGRPNSALETHRLVAFLERADSVISWDIQDEKNVTCQLTFWEASERTIRSEA EDSYHFSSAKMTATFLSKKQEVNMSDSALDCVRDEAINKLQQIFNTSYNQTYEKYGNVSV FETTGGLVVFWQGIKQKSLVELERLANRSSLNLTHNRTKRSTDGNNATHLSNMESVHNLV YAQLQFTYDTLRGYINRALAQIAEAWCVDQRRTLEVFKELSKINPSAILSAIYNKPIAAR FMGDVLGLASCVTINQTSVKVLRDMNVKESPGRCYSRPVVIFNFANSSYVQYGQLGEDNE ILLGNHRTEECQLPSLKIFIAGNSAYEYVDYLFKRMIDLSSISTVDSMIALDIDPLENTD FRVLELYSQKELRSSNVFDLEEIMREFNSYKQRVKYVEDKVVDPLPPYLKGLDDLMSGLG AAGKAVGVAIGAVGGAVASVVEGVATFLKNPFGAFTIILVAIAVVIITYLIYTRQRRLCT QPLQNLFPYLVSADGTTVTSGSTKDTSLQAPPSYEESVYNSGRKGPGPPSSDASTAAPPY TNEQAYQMLLALARLDAEQRAQQNGTDSLDGRTGTQDKGQKPNLLDRLRHRKNGYRHLKD SDEEENV 907
114 DNA polymerase catalytic subunit, EC 2.7.7.7 Q6SW77 MFFNPYLSGGVTGGAVAGGRRQRSQPGSAQGSGKRPPQKQFLQIVPRGVMFDGQTGLIKH KTGRLPLMFYREIKHLLSHDMVWPCPWRETLVGRVVGPIRFHTYDQTDAVLFFDSPENVS PRYRQHLVPSGNVLRFFGATEHGYSICVNVFGQRSYFYCEYSDTDRLREVIASVGELVPE PRTPYAVSVTPATKTSIYGYGTRPVPDLQCVSISNWTMARKIGEYLLEQGFPVYEVRVDP LTRLVIDRRITTFGWCSVNRYDWRQQGRASTCDIEVDCDVSDLVAVPDDSSWPRYRCLSF DIECMSGEGGFPCAEKSDDIVIQISCVCYETGGNTAVDQGIPNGNDGRGCTSEGVIFGHS GLHLFTIGTCGQVGPDVDVYEFPSEYELLLGFMLFFQRYAPAFVTGYNINSFDLKYILTR LEYLYKVDSQRFCKLPTAQGGRFFLHSPAVGFKRQYAAAFPSASHNNPASTAATKVYIAG SVVIDMYPVCMAKTNSPNYKLNTMAELYLRQRKDDLSYKDIPRCFVANAEGRAQVGRYCL QDAVLVRDLFNTINFHYEAGAIARLAKIPLRRVIFDGQQIRIYTSLLDECACRDFILPNH YSKGTTVPETNSVAVSPNAAIISTAAVPGDAGSVAAMFQMSPPLQSAPSSQDGVSPGSGS NSSSSVGVFSVGSGSSGGVGVSNDNHGAGGTAAVSYQGATVFEPEVGYYNDPVAVFDFAS LYPSIIMAHNLCYSTLLVPGGEYPVDPADVYSVTLENGVTHRFVRASVRVSVLSELLNKW VSQRRAVRECMRECQDPVRRMLLDKEQMALKVTCNAFYGFTGVVNGMMPCLPIAASITRI GRDMLERTARFIKDNFSEPCFLHNFFNQEDYVVGTREGDSEESSTLPEGLETSSGGLNER RVEARVIYGDTDSVFVRFRGLTPQALVARGPSLAHYVTACLFVEPVKLEFEKVFVSLMMI CKKRYIGKVEGASGLSMKGVDLVRKTACEFVKGVTRDVLSLLFEDREVSEAAVRLSRLSL DEVKKYGVPRGFWRILRRLVQARDDLYLHRVRVEDLVLSSVLSKDISLYRQSNLPHIAVI KRLAARSEELPSVGDRVFYVLTAPGVRAAPQGSSDNGDSVTTGVVSRSDAIDGTDDDADG GGVEESNRRGGEPAKKRARKPPSAVCNYEVAEDPSYVREHGVPIHADKYFEQVLKAVTNV LSPVFPGGETARKDKFLHMVLPRRLHLEPAFLPYSVKAHECC 1,242
115 Packaging protein UL32 F5HDH8 MNPSTHVSSNGPTTPPHGPHTTFLPPTSPAPSTSSVAAATLCSPQRQAVSRYSGWSTEYT QWHSDLTTELLWHAHPRQVPMDEALAAAAAASYQVNPQHPANRYRHYEFQTLSLGTSEVD ELLNCCAEETTCGGTQSTVLTNATNTTSCGGAVAGSSNAGPAGASAACDLDAELAGLETS AADFEQLRRLCAPLAIDTRCNLCAIISICLKQDCDQSWLLEYSLLCFKCSYAPRAALSTL IIMSEFTHLLQQHFSDLRIDDLFRHHVLTVFDFHLHFFINRCFEKQVGDAVDNENVTLNH LAVVRAMVMGEDTVPYNKPRRHPQQKQKNNPYHVEVPQELIDNFLEHSSPSRDRFVQLLF YMWAGTGVMSTTPLTELTHTKFARLDALSTASEREDARMMMEEEEDEEGGEKGGDDPGRH NGGGTSGGFSESTLKKNVGPIYLCPVPAFFTKNQTSTVCLLCELMACSYYDNVVLRELYR RVVSYCQNNVKMVDRIQLVLADLLRECTSPLGAAHEDVARCGLEAPTSPGGDSDYHGLSG VDGALARPDPVFCHVLRQAGVTGIYKHFFCDPQCAGNIRVTNEAVLFGHLHPHHVQEVKL AICHDNYYISRLPRRVWLCITLFKAFQITKRTYKGKVHLADFMRDFTQLLENCDIKLVDP TYVIDKYV 668
116 Nuclear egress protein 1 F5HFZ4 MSSVSGVRTPRERRSALRSLLRKRRQRELASKVASTVNGATSANNHGEPPSPADARPRLT LHDLHDIFREHPELELKYLNMMKMAITGKESICLPFNFHSHRQHTCLDISPYGNEQVSRI ACTSCEDNRILPTASDAMVAFINQTSNIMKNRNFYYGFCKSSELLKLSTNQPPIFQIYYL LHAANHDIVPFMHAENGRLHMHVIFENSDVHIPCDCITQMLTAAREDYSVTLNIVRDHVV ISVLCHAVSASSVKIDVTILQRKIDEMDIPNDVSESFERYKELIQELCQSSGNNLYEEAT SSYAIRSPLTASPLHVVSTNGCGPSSSSQSTPPHLHPPSQATQPHHYSHHQSQSQQHHHR PQSPPPPLFLNSIRAP 376
117 Nuclear egress protein 2 Q6SW81 MEMNKVLHQDLVQATRRILKLGPSELRVTDAGLICKNPNYSVCDAMLKTDTVYCVEYLLS YWESRTDHVPCFIFKNTGCAVSLCCFVRAPVKLVSPARHVGEFNVLKVNESLIVTLKDIE EIKPSAYGVLTKCVVRKSNSASVFNIELIAFGPENEGEYENLLRELYAKKAASTSLAVRN HVTVSSHSGSGPSLWRARMSAALTRTAGKRSPRTASPPPPPPRHPSCSPTMVAAGGAAAG PRPPPPPMAAGSWRLCRCEACMGRCGCASEGDADEEEEELLALAGEGKAAAAAAGQDIGG SARRPLEEHVSRRRGVSTHHRHPPSPPCTPSLERTGYRWAPSSWWRARSGPSRPQSGPWL PARFATLGPLVLALLLVLALLWRGHGQSSSPTRSAHRD 398
118 Tripartite terminase subunit 2 F5HGI9 MSWAKQRVPFLDDDDGEEENDVQDDVDSPVPTRPLVIDEDAEPAAGTSGGLEGGGGDDED GEDGHALPDLDDDLLLQFEPMLPRVYDLLLPSLDARLNFVNAGQKYAAFLKYVHGDCATC SHGEILREKTQLLTAIVSKLMDINGILEGKDEPAPGK 157
119 Protein UL49 Q6SW82 MANRRLRHAPHTATDEFHQALRRLFAPLCVHEDHFHVQLVIGRGALQPEEAAVETSQPPA QFAAQTSAVLQQQLVHHVPRSCVLHLFVTDKRFLNRELGDRLYQRFLREWLVCRQAEREA VTALFQRMVMTKPYFVFLAYVYSMDCLHTVAVRTMAFLRFERYDTDYLLRRLRLYPPERL HALLDGVTVSLLGDLHRFLFGVDLRLPVLHPTSSPCLALLRAKRFDARADLAVYHRNQWC HQRQPRSPQLRGLIAALRRHAGKVPCGNPLYVLARQAVQTFCDTCPRYLVPLRALGLHDE TRGGGSTAAAAAVGHAGAGQQAHHVEPTKIVLFALSAALRGGLIGSVIDLPLWCLCRLKC ERHLDARSLVAVVCRQCGHCLNLGKEKLHCQQNFPLNSMFYYRDRQEKSVIFNTHAELVH CSLCGSQRVVRQRVYELVSETLFGQRCVRVGWKAVLGLNAACAVYDHRLAFDVILPCAAR TCDSTVVVRGVTVPRLLRLTSHGHGLLCARCQTGEYRDSCLESEDGAPLCRGCALVKQTA CHVGGHIVQQARGGLAATSSSSSPHGLPHV 570
120 Large tegument protein deneddylase, EC 3.4.19.12, EC 3.4.22.- Q6SW84 MKVTQASCHQGDIARFGARAGNQCVCNGIMFLHALHLGGTSAVLQTEALDAIMEEGARLD ARLERELQKKLPAGGRLPVYRLGDEVPRRLESRFGRTVHALSRPFNGTTETCDLDGYMCP GIFDFLRYAHAKPRPTYVLVTVNSLARAVVFTEDHMLVFDPHSSAECHNAAVYHCEGLHQ VLMVLTGFGVQLSPAFYYEALFLYMLDVATVPEAEIAARLVSTYRDRDIDLTGVVRESAD TAATTTTAAPSLPPLPDPIVDPGCPPGVAPSIPVYDPSSSPKKTPEKRRKDLSGSKHGGK KKPPSTTSKTLATASSSPSAIAAASSSSAVPPSYSCGEGALPALGRYQQLVDEVEQELKA LTLPPLPANTSAWTLHAAGTESGANAATATAPSFDEAFLTDRLQQLIIHAVNQRSCLRRP CGPQSAAQQAVRAYLGLSKKLDAFLLNWLHHGLDLQRMHDYLSHKTTKGTYSTLDRALLE KMQVVFDPYGRQHGPALIAWVEEMLRYVESKPTNELSQRLQRFVTKRPMPVSDSFVCLRP VDFQRLTQVIEQRRRVLQRQREEYHGVYEHLAGLITSIDIHDLDASDLNRREILKALQPL DDNAKQELFRLGNAKMLELQMDLDRLSTQLLTRVHNHILNGFLPVEDLKQMERVVEQVLR LFYDLRDLKLCDGSYEEGFVVIREQLSYLMTGTVRDNVPLLQEILQLRHAYQQATQQNEG RLTQIHDLLHVIETLVRDPGSRGSALTLALVQEQLAQLEALGGLQLPEVQQRLQNAQLAL SRLYEEEEETQRFLDGLSYDDPPTEQTIKRHPQLREMLRRDEQTRLRLINAVLSMFHTLV MRLARDESPRPTFFDAVSLLLQQLPPDSHEREDLRAANATYAQMVKKLEQIEKAGTGASE KRFQALRELVYFFRNHEYFFQHMVGRLGVGPQVTELYERYQHEMEEQHLERLEREWQEEA GKLTVTSVEDVQRVLARAPSHRVMHQMQQTLTTKMQDFLDKEKRKQEEQQRQLLDGYQKK VQQDLQRVVDAVKGEMLSTIPHQPLEATLELLLGLDQRAQPLLDKFNQDLLSALQQLSKK LDGRINECLHGVLTGDVERRCHPHREAAMQTQASLNHLDQILGPQLLIHETQQALQHAVH QAQFIEKCQQGDPTTAITGSEFESDFARYRSSQQKMEGQLQETRQQMTETSERLDRSLRQ DPGSSSVTRVPEKPFKGQELAGRITPPPADFQRPVFKTLLDQQADAARKALSDEADLLNQ KVQTQLRQRDEQLSTAQNLWTDLVTRHKMSGGLDVTTPDAKALMEKPLETLRELLGKATQ QLPYLSAERTVRWMLAFLEEALAQITADPTHPHHGSRTHYRNLQQQAVESAVTLAHQIEQ NAACENFIAQHQEATANGASTPRVDMVQAVEAVWQRLEPGRVAGGAARHQKVQELLQRLG QTLGDLELQETLATEYFALLHGIQTFSYGLDFRSQLEKIRDLRTRFAELAKRCGTRLSNE GALPNPRKPQATTSLGAFTRGLNALERHVQLGHQYLLNKLNGSSLVYRLEDIPSVLPPTH ETDPALIMRDRLRRLCFARHHDTFLEVVDVFGMRQIVTQAGEPIYLVTDYGNVAFKYLAL RDDGRPLAWRRRCSGGGLKNVVTTRYKAITVAVAVCQTLRTFWPQISQYDLRPYLTQHQS HTHPAETHTLHNLKLFCYLVSTAWHQRIDTQQELTAADRVGSGEGGDVGEQRPGRGTVLR LSLQEFCVLIAALYPEYIYTVLKYPVQMSLPSLTAHLHQDVIHAVVNNTHKMPPDHLPEQ VKAFCITPTQWPAMQLNKLFWENKLVQQLCQVGPQKSTPSLGKLWLYAMATLVFPQDMLQ CLWLELKPQYAETYASVSELVQTLFQIFTQQCEMVTEGYTQPQLPTGEPVLQMIRVRRQD TTTTDTNTTTEPGLLDVFIQTETALDYALGSWLFGIPVCLGVHVADLLKGQRVLVARHLE YTSRDRDFLRIQRSRDLNLSQLLQDTWTETPLEHCWLQAQIRRLRDYLRFPTRLEFIPLV IYNAQDHTVVRVLRPPSTFEQDHSRLVLDEAFPTFPLYDQDDNTSADNVAASGAAPTPPV PFNRVPVNIQFLRENPPPIARVQQPPRRHRHRAAAAADDDGQIDHAQDDTSRTADSALVS TAFGGSVFQENRLGETPLCRDELVAVAPGAASTSFASPPITVLTQNVLSALEILRLVRLD LRQLAQSVQDTIQHMRFLYLL 2,241
121 Small capsomere-interacting protein F5HEN7 MSNTAPGPTVANKRDEKHRHVVNVVLELPTEISEATHPVLATMLSKYTRMSSLFNDKCAF KLDLLRMIAVSRTRR 75
122 Inner tegument protein Q6SW85 MMARRTVDFKKLIEQLRARATDKAEALNTVSQLEIGAVDAQDVTASAVRAFVGALPSSGY HFGFVRQNVVFYLLSHATVQTARDPLYAAEQLHEQLDRFLRHQHDGGGDEDRLPFYHNGA TLTAFQKLLQTLREIQTVIAEQSGGTAAAADLIASNNASTERRGKKGGSSSGGQQPLVRR VITQLETAATEARPYVNCRAVAELLDLTYQRLIYWACTLMPYVLFRRDTDTELDTVLLMH FFYTHYRSVNGDLAVEFQNYVKNSVRHMSSFVSSDIDGDQKPGAEHMRDVSYKLFVGNLQ ARDASGLMFPIISTRISTVNLYLSPERMFFHPGLISRLLSEEVSPRANLDAYARVCDRVL EDHLHTPRRVQRLLDLTQMVMRLVELGFNHDTCAAYAQMALIQPASQKSSLFVSEIREKL IQIIYNFYTFFMCLYVYSPTFLFDHRRRLILEQHRSTLIGSKEELQHVWSNVTLNVNTHF AVQYTEEDFEAHTKGATEAEREYLYRDLHSKWGVHLFTLRPSRGAAGAASPLPPLDGVTR SDILRECALVNLNEGRVNYASLLAFSHHPEFPSIFAQLVVVTEFSEIFGIPQGLFQAVGS PRLFALIQLCRVLLPEQVTLYQNLVSIYNLTTFVKHIDAAVFKTVRDCVFDIATTLEHLS GVPVTPNVDLLAELMARSVAHNLYTTVNPLIEDVMRSSAGSLRNYLRHTRLCFGLARGRA RLSEDGVTVYVEVQGQYGLRVPTTRFVEQLRELVRRDRLLAENLRGLNERLLSVRVRVRQ ISSDTEEVSRHAKGHRTVAQMSKALKKTASKIKMLETRVTLALEQAQRSNGAVVTAVQRA LAVFDVLSRENLERRGAQLCLTEATSLLHRHRALAPMTWPAGTGVAAAAEADGALREFLE APWESAPQPPRLRMTPDTDHEESTAGATSVPEVLGARYEPAHLAASDLLNWYIVPVSQAQ QDILSSIDPPAGSTSVSLPPASP 983
123 Triplex capsid protein 1 F5HA93 MDARAVAKRPRDPADEDNELVTALKAKREVNTISVRYLYHADHQALTARFFVPEGLVEFE AQPGALLIRMETGCDSPRHLYISLYLLGIRASNVSASTRCLLESVYTASAARAALQWLDL GPHLLHRRLETLGCVKTVSLGITSLLTCVMRGYLYNTLKTEVFALMIPKDMYLTWEETRG RLQYVYLIIVYDYDGPETRPGIYVLTSSIAHWQTLVDVARGKFARERCSFVNRRITRPRQ IPLCTGVIQKLGWCLADDIHTSFLVHKELKLSVVRLDNFSVELGDFREFV 290
124 Ribonucleoside-diphosphate reductase large subunit-like protein Q6SW87 MNPADADEEQRVSSVPAHRCRPGRIPSRSAETETEESSAEVAADTIGGDDSELEEGPLPG GDKEASAGNTNVSSGVACVAGFTSGGGVVSWRPESPSPDGTPSVLSLTRDSGPAVPSRGG RVSSGLSTFNPAGATRMELDSVEEEDDFGASLCKVSPPIQAMRMLMGKKCHCHGYWGKFR FCGVQEPARELPSDRNALWREMDTVSRHSAGLGSFRLFQLIMRHGPCLIRHSPRCDLLLG RFYFKANWARESRTPLCYASELCDESVRRFVLRHMEDLPKLAEETARFVELAGCWGLYAA ILCLDKVCRQLHGQDESPGGVFLRIAVALTAAIENSRHSRIYRFHLDARFEGEVLESVLK RCRDGQLSLSTFTMSTVGFDRVPQYDFLISADPFSRDASWAAMCKWMSTLSCGVSVSVNV TRLNADVNSVIRCLGGYCDLIREKEVHRPVVRVFVDMWDVAAIRVINFILKESTSELTGV CYAFNVPSVLMKRYRAREQRYSLFGRPVSRRLSDLGQESAFEKEYSRCEQSCPKVVVNTD DFLKKMLLCALKGRASVVFVHHVVKYSIMADSVCLPPCLSPDMASCHFGECDMPVQRLTV NVARCVFARSDEQKLHLPDVVLGNTRRYFDLSVLRELVTEAVVWGNARLDALMSASEWWV ESALEKLRPLHIGVAGLHTALMRLGFTYFASWDLIERIFEHMYFAAVRASVDLCKSGLPR CEWFERTIYQEGKFIFELYRLPRLSIASARWEALRADMLEFGLRNCQFLAVGPDDEVAHL WGVTPSVWASRGTVFEEETVWSLCPPNRECYFPTVVRRPLRVPVVNYAWLEQHQEEGKAT QCLFQAAPAIQNDVEMAAVNLSVFVDQCVALVFYYDSGMTPDVLLARMLKWYHWRFKVGV YKYCAS 906
125 DNA polymerase processivity factor (Polymerase accessory protein, PAP) (Protein ICP36) F5HC97 MDRKTRLSEPPTLALRLKPYKTAIQQLRSVIRALKENTTVTFLPTPSLILQTVRSHCVSK ITFNSSCLYITDKSFQPKTINNSTPLLGNFMYLTSSKDLTKFYVQDISDLSAKISMCAPD FNMEFSSACVHGQDIVRESENSAVHVDLDFGVVADLLKWIGPHTRVKRNVKKAPCPTGTV QILVHAGPPAIKFILTNGSELEFTANNRVSFHGVKNMRINVQLKNFYQTLLNCAVTKLPC TLRIVTEHDTLLYVASRNGLFAVENFLTEEPFQRGDPFDKNYVGNSGKSRGGGGGSGSLS SLANAGGLHDDGPGLDNDIMNEPMGLGGLGGGGGGGGKKHDRGGGGGSGTRKMSSGGGGG DHDHGLSSKEKYEQHKITSYLTSKGGSGGGGGGGGGGLDRNSGNYFNDAKEESDSEDSVT FEFVPNTKKQKCG 433
126 Tegument protein UL43 Q6SW89 MEKTPAETTAVSAGNVPRDSIPCITNVSADTRGRTRPSRPATVPQRRPARIGHFRRRSAS LSFLDWPDDSVTEGVRTTSASVAASAARFDEIRRRRQSINDEMKERTLEDALAVELVNET FRCSVTSDARKDLQKLVRRVSGTVLRLSWPNGWFFTYCDLLRVGYFGHLNIKGLEKTFLC CDKFLLPVGTVSRCEAIGRPPLPVLIGEGGRVYVYSPVVESLYLVSRSGFRGFVQEGLRN YAPLREELGYVRFETGGDVGREFMLARDLLALWRLCMKREGSIFSWRDGNEALTTVVLNG SQTYEDPAHGNWLKETCSLNVLQVFVVRAVPVESQQRLDISILVNESGAVFGVHPDTRQA HFLARGLLGFFRVGFLRFCNNYCFARDCFTHPESVAPAYRATGCPRELFCRRLRKKKGLF ARR 423
127 Protein UL42 F5HHZ3 MEPTPMLRDRDHDDAPPTYEQAMGLCPTTVSTPPPPPPDCSPPPYRPPYCLVSSPSPRHT FDMDMMEMPATMHPTTGAYFDNGWKWTFALLVVAILGIIFLAVVFTVVINRDSANITTGT QASSG 125
128 Protein UL41A F5HFG3 MTLFCRTANSTAGYVDMNVCIGMIGVVCFVFGVFILIFCSTLKAFYVRQKTYHLLGTESD DEETTVWEKRRMESDTDF 78
129 Protein UL40 Q6SW92 MNKFSNTRIGFTCAVMAPRTLILTVGLLCMRIRSLLSSPVETTVTTAGVTSAHGPLCPLV FQGWAYAVYHQGDMVLMTLDVYCCRQTSSNTVVAFSHHPADNTLLIEVGNNTRRHVDGIS CQDHFRAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGL ETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKKA 221
130 Apoptosis inhibitor UL38 F5HG98 MTTTTHSTAAIMSLLDEAEWRQTQMDVGGLIQASALGKVALRYAVRKLMKRGARLRHDSG LYVCICDPSYEFLQMNLSKISWLERHCPPLDQELIMFGVIEAWEEASVRPTRQLVLFMTP KWDVFAYDSGILFFLAPSMAQFWHGAIVLEYWNALFPVEVRSHVRQHAHTMDDLVMVFHQ LDYEKQVLEARRDKNTEGPRTFAKSVNSYVRAILESERRIREGKIPMTFVDRDSLRANSL AHIQATGAQPSHAPAQRVLSAPPSLPSPVSEEDPAAAATPPSSAATTPPSSVVPASVESE LSSSPPLPPVVVKDVMYTAGEGDVVQMVVVV 331
131 UL37 immediate early glycoprotein Q6SW94 MSPVYVNLLGSVGLLAFWYFSYRWIQRKRLEDPLPPWLRKKKACALTRRSRHRLRRQHGV IDGENSETERSVDLVAALLAEAGEESVTEDTEREDTEEEREDEEEENEARTPEVNPMDAE GLSGLAREACEALKKALRRHRFLWQRRRRARLLQHNGPQQSHHAAVFCRVHGLRGFQVSV WLLLTLFWSTGYGVSVRCTYHGTDINVTSNATSMNCRLNCTCNHTQIYNGPCAGAESKLP LNVTFRQSRRQWHSVMLTFGFQYHLEGWFPLRILNESRDINVTEVYGEVACFTNDTNITM GQLTLNLTGRSYVLRALARTSPFESSVNWEETNVTDNATSSENNTVTVMSVLTVYAESDY IFLQDMCPRFLKRSVKLAKNNRRNTTFTGTNVTSLPEWTLQQCQGWKYWTTLSIMWKNRR SALLRAKSRALGHWALLSICTVAAGSIALLSLFCILLIGLRRDLLEDFRYICRDEGSSST KNDVHWIV 488
132 Viral inhibitor of caspase-8-induced apoptosis, vICA F5HAY6 MDDLRDTLMAYGCIAIRAGDFNGLNDFLEQECGTRLHVAWPERCFIQLRSRSALGPFVGK MGTVCSQGAYVCCQEYLHPFGFVEGPGFMRYQLIVLIGQRGGIYCYDDLRDCIYELAPTM KDFLRHGFRHCDHFHTMRDYQRPMVQYDDYWNAVMLYRGDVESLSAEVTKRGYASYSIDD PFDECPDTHFAFWTHNTEVMKFKETSFSVVRAGGSIQTMELMIRTVPRITCYHQLLGALG HEVPERKEFLVRQYVLVDTFGVVYGYDPAMDAVYRLAEDVVMFTCVMGKKGHRNHRFSGR REAIVRLEKTPTCQHPKKTPDPMIMFDEDDDDELSLPRNVMTHEEAESRLYDAITENLMH CVKLVTTDSPLATHLWPQELQALCDSPALSLCTDDVEGVRQKLRARTGSLHHFELSYRFH DEDPETYMGFLWDIPSCDRCVRRRRFKVCDVGRRHIIPGAANGMPPLTPPHAYMNN 476
133 Tegument protein UL35 F5HE12 MAQGSRAPSGPPLPVLPVDDWLNFRVDLFGDEHRRLLLEMLTQGCSNFVGLLNFGVPSPV YALEALVDFQVRNAFMKVKPVAQEIIRICILANHYRNSRDVLRDLRTQLDVLYSEPLKTR LLRGLIRLCRAAQTGVKPEDISVHLGADDVTFGVLKRALVRLHRVRDALGLRASPEAEAR YPRLTTYNLLFHPPPFTTVEAVDLCAENLSDVTQRRNRPLRCLTSIKRPGSRTLEDALND MYLLLTLRHLQLRHALELQMMQDWVVERCNRLCDALYFCYTQAPETRQTFVTLVRGLELA RQHSSPAFQPMLYNLLQLLTQLHEANVYLCPGYLHFSAYKLLKKIQSVSDARERGEFGDE DEEQENDGEPREAQLDLEADPTAREGELFFFSKNLYGNGEVFRVPEQPSRYLRRRMFVER PETLQIFYNFHEGKITTETYHLQRIYSMMIEGASRQTGLTPKRFMELLDRAPLGQESEPE ITEHRDLFADVFRRPVTDAASSSSASSSSSSASPNSVSLPSARSSSTRTTTPASTYTSAG TSSTTGLLLSSSSLSGSHGISSADLEQPPRQRRRMVSVTLFSPYSVAYSHHRRHRRRRSP PPAPRGPAHTRFQGPDSMPSTSYGSDVEDPRDDLAENLRHL 641
134 Transcriptional regulator UL34 F5HC16 MNFIITTRDFSNDDSVLRAAEMRDNVAGSISKAYKGTVRAEGKKKLLLKHLPVPPGGCSR RNSNLFVFCTERDYRKFHQGIAQLKRAPAELDPHEIQQVTASIRCRLQPSLREPPTPADE LQTAVSRVCALFNQLVFTAQLRHYCEHQDKVVSYARDELTKRCGEKSALGVEVHQLVALL PHERHRELCHVLIGLLHQTPHMWARSIRLIGHLRHYLQNSFLHLLMNSGLDIAQVFDGCY HSEAYRMLFQIGHTDSVSAALELSHSAAAGPPEADENNDEGEEDDDELRHSDPAPLHDSK KPRNARRPRTRVPPHEQKPEENEEEEEELFPSCKATAAFLRAEPSVSNDDGNGGERCDTL ATALRHRADEEDGPLASQTSVRVAATPSPSVTSALTPVTSPITPLCI 407
135 G-protein coupled receptor homolog UL33 Q6SW98 MDTIIHNTTNRSTDTPHVNITCNITEPLSAIRTTEAVINTFIIFVGGPLNAIVLITQLLT NRVLGYSTPTIYMTNLYSTNFLTLTVLPFIVLSNQWLLPASVASCKFLSVIYYSSCTVGF ATVALIAADRYRVLHKRTYARQSYRSTYIILLLTWFAGLIFSMPAAVYTTVVIHNGTNGQ SSNGHATCVLYFIADEVYTVLLSWKVLLTLVWGAAPVIMMTWFYAFFYSTVQRASQKQRS RTLTFVSVLLISFVALQTPYVSIMIFNSYATAAWPMDCEHLTLRRTIGTLSRLVPHLHCL INPILYALLGHDFLQRMRQCFRGQLLDRRAFLRSQQNQRATAETNLAAGNNSQSVATSLD TSSKNCNQHAKRSVSFNFPSGTWKGGQKTASNDTSTKIPHRLSQSHHNLSGV 412
136 Tegument protein pp150 Q6SW99 MSLQFIGLQRRDVVALVNFLRHLTQKPDVDLEAHPKILKKCGEKRLHRRTVLFNELMLWL GYYRELRFHNPDLSSVLEEFEVRCAAVARRGYTYPFGDRGKARDHLAVLDRTEFDTDVRH DAEIVERALVSAVILAKMSVRETLVTAIGQTEPIAFVHLKDTEVQRIEENLEGVRRNMFC AKPLDLNLDRHANTALVNAVNKLVYTGRLIMNVRRSWEELERKCLARIQERCKLLVKELR MCLSFDSNYCRNILKHAVENGDSADTLLELLIEDFDIYVDSFPQSAHTFLGARSPSLEFD DDANLLSLGGGSAFSSVPKKHVPTQPLDGWSWIASPWKGHKPFRFEAHGSLAPAAEAHAA RSAAVGYYDEEEKRRERQKRVDDEVVQREKQQLKAWEERQQNLQQRQQQPPPPTRKPGAS RRLFGSSADEDDDDDDDDEKNIFTPIKKPGTSGKGAASGGGVSSIFSGLLSSGSQKPTSG PLNIPQQQQRHAAFSLVSPQVTKASPGRVRRDSAWDVRPLTETRGDLFSGDEDSDSSDGY PPNRQDPRFTDTLVDITDTETSAKPPVTTAYKFEQPTLTFGAGVNVPAGAGAAILTPTPV NPSTAPAPAPTPTFAGTQTPVNGNSPWAPTAPLPGDMNPANWPRERAWALKNPHLAYNPF RMPTTSTASQNTVSTTPRRPSTPRAAVTQTASRDAADEVWALRDQTAESPVEDSEEEDDD SSDTGSVVSLGHTTPSSDYNNDVISPPSQTPEQSTPSRIRKAKLSSPMTTTSTSQKPVLG KRVATPHASARAQTVTSTPVQGRLEKQVSGTPSTVPATLLQPQPASSKTTSSRNVTSGAG TSSASSARQPSASASVLSPTEDDVVSPATSPLSMLSSASPSPAKSAPPSPVKGRGSRVGV PSLKPTLGGKAVVGRPPSVPVSGSAPGRLSGSSRAASTTPTYPAVTTVYPPSSTAKSSVS NAPPVASPSILKPGASAALQSRRSTGIAAVGSPVKSTTGMKTVAFDLSSPQKSGTGPQPG SAGMGGAKTPSDAVQNILQKIEKIKNTEE 1,049
137 Protein UL31 Q6SWA0 MGDKPTLVTLLTVAVSSPPPSSPLPLVSFTELLLPPPSVAAAAVAATATSEVGEKTAEQE VAAAGPETRNERRENREDEGGETRTTGTTAVKRSHDGIPRQLAERLRLCRHMDPEQDYRL PAQDVVTSWIEALRDADRDNYGRCVRHAKIHRSASHLTAYESYLVSITEQYNTASNVTEK ASYVQGCIFLSFPVIYNNTQGCGYKYDWSNVVTPKAAYAELFFLLCSTSESSVVLQPLIT KGGLCSSMAVYDEETMRQSQAVQIGFLHTQLVMVPFVPHACPHYAVPFTTPGKPGCGGAP SGVAGLEETAPFGRVSVTRHGATLLCRVDHLTWISKRVTTYGHKKITRYLAQFRGTMDDD EAALPGEDEAWIASKNVQYEFMGLIFTVNVDSLCVDAEQRQLLGTVATSFCHRVSDKITA RNMPRAFSFYLLTSAQRGYDLRFSRNPSLFFSGDALNCPLLNEPNVFSLTVHAPYDIHFG VQPRQTVELDLRYVQITDRCFLVANLPHEDAFYTGLSVWRGGEPLKVTLWTRTRSIVIPQ GTPIATLYQITEGDGNVYSYNHHTVFRQMHAAGATTFFLGDMQLPADNFLTSPHP 595
138 Uncharacterized protein UL30 F5HGC2 MTTSAMTAPDTRRQLQHVETLRRFLRGDSCFVHDLRGMMDYHDGLSRRQQRAFCRAGRVL TDPEPIQSETEGENKQFTEHTHKVVSFFIKSVFVFPCLVLPNCCQVSVDRSRVPETGGRW L 121
139 Protein UL27 Q6SWA4 MNPVDQPPPPPLTQQPEEQAKEDHDDGDERLFRDPLTTYEYLDDCRDDEEFCHQFLRAYL TPIRNRQEAVRAGLLCRTPEDLAAAGGQKRKTPAPKHPKHAMVYIRRSCLVHSACATAHG KYDIRGLTLESDLAVWAALRGVPLPPDPQHFRWLNAGAFRRLVHEAQYLPEISRAAKRIA LAVATGQYVVCTLLDYKTFGTRTHYLRQLCSMTEELYLRLDGTLCLFLEPEERELIGRCL PAALCRGLPVKYRTHRAAVFFHATFMARAEAALKDLYAAFCECGDGRDDGGNHNGNYGGG DHSSLSPSAVASHHSRLEHAELRLERNRHLGAFHLPAIRHLTAGDVARVQDSVSRDLGFA DWSQTLVDDYFLLPAGWACANPRRGYAMYLASNAVLALRIIRLLRASIRHEYTACIRMLS GDVQRLIRLFKGEAALLRKGLAQNPVQRRELSRFRKHVHDLKRIRFTEDTFVETFCDFLE LVQRIPDYRSVSLRIKRELLCLHVFKLRRGCRAPPTPEAVRVQRLLWHSLRHGDAPQDRT RLPQFSSALSDAELSNHANRCRRKAPLELGPAVVAAPGPSVRYRAHIQKFERLHVRRFRP HEVGGHAT 608
140 Tegument protein UL26 F5HGG3 MYAVFGLTRSEVTPHEAAAARYKHRGVIDRRGAAMTSRRAPDGGLNLDDFMRRQRGRHLD LPYPRGYTLFVCDVEETILTPRDVEYWKLLVVTQGQLRVIGTIGLANLFSWDRSVAGVAA DGSVLCYEISRENFVVRAADSLPQLLERGLLHSYFEDVERAAQGRLRHGNRSGLRRDADG QVIRESACYVSRALLRHRVTPGKQEITDAMFEAGNVPSALLP 222
141 Phosphoprotein 85, pp85 (Phosphoprotein UL25) F5HGJ4 MSSRRRSSSRRSGEPSTVIYIPSSNEDTPADEEAEDSVFTSTRARSATEDLDRMEAGLSP YSVSSDAPSSFELVRETGGTGAAKKPSEKKRSSSRRQPQIAAGAPRGSPATPKAGKSPKV SRPPSVPSLPENGAGGGGDDNSSSGGSSSRTTSNSSRSTSPVAPGEPSAAEGDEFSFCDS DIEDFERECYRVSVADNLGFEPSVVAPQHVEYLKFVLQDFDVQHLRRLNECIPMPAFALT SLVDPVLNNVAPGERDLTRRIITHAVIINYYYVAQKKARHMVEAIRTTVRGDTVRRVAAQ VNNQSRSGRAAALALHFLTSRKGVTDGQYATSLRRLDEELRHRGTPESPRLTEVYQTLRD YNVLFYTAHYTSRGALYLYRQNLQRLNENHRGMLRLLSVEEICEEHTLNDLAFLVGVELM ITHFQRTIRVLRCYLQHQLQSISELCYLIYVQLPSLREDYAQLSDVIYWAVSQNYDYALY ASTPALFDFLRVVRQQDAFICTDYVYCALRLLACPDRPIIGDTGGSSSSQRLVGEFMVRD PLLRDPRATHLRQKLITRDICVARLQAQPSSRHIPVEHTGVSSVTLLKIFSQVPPDEREE DTLREMALKAFMEANGNHPEQICRSPPPPLPPRDYPQRDERDRHRRDRRDSGEYCC 656
142 Tegument protein UL23 F5HDM3 MSVIKDCFLNLLDRWRPPKTSRPWKPGQRVALVWPKDRCLVIRRRWRLVRDEGRDAQRLA SYLCCPEPLRFVGSICTYNFLKHKGDHNVPSELYLGASGAMYLWTDHIYSDSLTFVAESI TEFLNIGLRRCNFITVPEELPHTASLRALAGCMHIHAFAQWRATYRGRLMVMGDYSVIRV STIRLYDWSEINDWRVMVGSNHVEPLGWLVSPYDVINLFVDDCMRVFAANNQHVCIVADS LMEFVTRGMTRCHENGIYYGTRSMRKLNKPTCPYGVDHQLFDDA 284
143 Glycoprotein UL22A F5HF90 MARRLWILSLLAVTLTVALAAPSQKSKRSVTVEQPSTSTNSDGNTTPSKNVTLSQGGSTT DGDEDYSGGDYDVLITDTDGGNHQQPQEKTDEHKGEHTKENEKTQ 105
144 Uncharacterized protein UL21A F5HH39 MGGSPVPQLTTVTQGLMPSVRMDFRARRPLRRLAFYAPRARRRLFQNHIHPEQRRVLVGE GDEEMLPDLPMEIDIVIDRPPQQPLPNPLVLLLDDVPPHVPGFAPYRVPRPHPMIPEEHW DQF 123
145 Membrane protein UL20 F5H9Z4 MLGIRAMLVMLDYYWIQLITNNGTRSNNTDTIFVSLLTGPNGVTRTAIGGLYSNYTNLTG AFGFTSTNMSATNSSAEDNWSVTNLTESCINRGESYVTTIWLLDCTKNDTYWYYGNAYNH TCEGTISGYLLGMCKLWKSWVNNITSYNTVRVESLGNETRCMLLPRQYTLNATVEWYNKS EGDVPEEFMDYVILTPLAVLTCGLQEAYILDKGRRYMYLFSVSCVGITGTVSIILVSLSL LILICYYRCGRLLICPRGFELLPEFTEEEEEKEKLLTHNDIEVQVPIRTRRLLVPWIRES KMWVLPPPLPPRPPHLIEFPPSPPPSPGPMHMVVCMPA 338
146 Uncharacterized protein UL19 F5HI68 MTSNALYELFRRRLPRAPVNTVMFLTRRTRDGFCGRLTSIATNSHYTMFVLDHGSVRIER PSQSEVDCASLMETLKRIRLRNSWVASEDELDVSRRDA 98
147 Membrane glycoprotein UL18 F5HFB4 MMTMWCLTLFVLWMLRVVGMHVLRYGYTGIFDDTSHMTLTVVGIFDGQHFFTYHVNSSDK ASSRANGTISWMANVSAAYPTYLDGERAKGDLIFNQTEQNLLELEIALGYRSQSVLTWTH ECNTTENGSFVAGYEGFGWDGETLMELKDNLTLWTGPNYEISWLKQNKTYIDGKIKNISE GDTTIQRNYLKGNCTQWSVIYSGFQTPVTHPVVKGGVRNQNDNRAEAFCTSYGFFPGEIN ITFIHYGNKAPDDSEPQCNPLLPTFDGTFHQGCYVAIFCNQNYTCRVTHGNWTVEIPISV TSPDDSSSGEVPDHPTANKRYNTMTISSVLLALLLCALLFAFLHYFTTLKQYLRNLAFAW RYRKVRSS 368
148 Protein UL17 F5HHT4 MDHALFTHFVGRPRHCRLEMLILDEQVSKRSWDTTVYHRRRKHLPRRRAPCGPQRPAEIP KRRKKAAVLLFWHDLCWLFRRLFFPREDSEPLMSDPARSPEEEE 104
149 Protein UL16 F5HG68 MERRRGTVPLGWVFFVLCLSASSPCAVDLGSKSSNSTCRLNVTELASIHPGETWTLHGMC ISICYYENVTEDEIIGVAFTWQHNESVVDLWLYQNDTVIRNFSDITTNILQDGLKMRTVP VTKLYTSRMVTNLTVGRYDCLRCENGTMKIIERLYVRLGSLYPRPPGSGLAKHPSVSADE ELSATLARDIVLVSAITLFFFLLALRIPQRLCQRLRIRLPHRYQRLRTED 230
150 Uncharacterized protein UL15A F5HAE6 MKRMIRSHGRKTECQMTGAGERRGSAVGALICGSGTRRGSGANERRDSDVGPIAHSSGTR RGSANETSACTRTDHQKADIGLWFMFLVFGLCSWLAMRYRAQ 102
151 Uncharacterized protein UL14 Q6SWB7 MGGGRLPPLWLPLLIAWSEWGNCCLDAPPVVRSPCLQPVRDRNRERNPGSPQLLPYGDRL EVACIFPAHDWPEVSIRVHLCYWPEIVRSLVVDARSGQVLHNDASCYIAGGRWRFEDGGA AQRLSLSFRLITETAGTYTCVLGNETHSLATETTALVADVHDLRHSDRSCDLAFGSRSQT RYLWTPDPSRLRSINCGWEGERHRVVHYIPGTSGLLPSCEEDERELCVPFISQSIADNNC SRRHRVDGARRRYHLRRDYWLTDPKIGLLAAGSVALTSLCHLLCYWCSESYRRLNTEEEN EAAEETAAGEASAVAAAAVSEEEQQRE 327
152 Uncharacterized protein UL13 Q6SWB8 MLWAHCGRFLRYHLLPLLLCRLPFLLFFQRPQWAHGLDIVEEDEWLREIQGATYQLSIVR QAMQHAGFQVRAASVMTRRNAVDLDRPPLWSGSLPHLPVYDVRSPRPLRPPSSQHHAVSP ELPSRNGIRWQYQELQYLVEEQRRRNQSRNAIPRPSFPPPDPPSQPAEDARDADAERAES PHTAESTVSHDASDNAVRRRHERRRYNALTVRSRDSLLLTRIRFSNQRCFGRGRLRHPAG SGPNTGGPRPGGAGLRQLRQQLTVRWQLFRLRCHGWTQQVSSQIRTRWEESNVVSQTATR VRTWFVQRTTLWRRTWVPGQNPAAEAQELAIIPPAPTVLRQNEEPRQQLTGEETRNSTHT QREEVEDVSREGAREGNDGSRASGNDERRNNAGRYDDDHEVQEPQVTYPAGQGELNRRSQ EENEEGGPCESPPMTTNTLTVACPPREPPHRALFRLCLGLWVSSYLVRRPMTI 473
153 Protein UL11 Q6SWB9 MLFRYITFHREKVLYLTAACIFGVYISLHDACIPVVGKIGTNVTLNAVDVLPPRDQVRWS YGPGGQGYMLCIFTGTSTTTFNNTRFNFSCLSNYSLLLINVTTQYSTTYRTMTSLDHWLH QRHNHGSRWTLDTCYNLTVNENGTFPTTTTKKPTTTTRTTTTTTQRTTTTRTTTTAKKTT ISTTHHKHPSPKKSTTPNSHVEHHVGFEATAAETPLQPSPQHQHLATHALWVLAVVIVII IIIIFYFRIPQKLWLLWQHDKHGIVLIPQTDL 272
154 Uncharacterized protein UL10 Q6SWC0 MRQLINHIVNHDLFRWSVVTAMIFYRYSETCMEVTVRVGDPVTLGSGHGYHPGQKVHWYN QSCVGIGNGENTHPICTYDPPKPGRQKTMKTTPLPSPLLYECHNSTLSILHVNVSDPRNY CRRKCPPKGNCEFPTCFTLSLISRTTTRKPEQKTTLLRLKTTPNKHTQHKRSTRRTSPKD YNVTGLPKGFADSFTGNVEAHRTKDAAHSAWILIIIIIIIVVILFFFKIPQRLREKWDTK GYLYKGTDGLPTTD 254
155 Membrane glycoprotein UL9 F5H9T4 MSKRLQVFPWITILFYTSKSQYWNYMTIPCTPTVGYGSHNISLHPLNNSLFQDDVFEWYI DKPMVTNKLCLYQSNERIKSNLDSPNIMWQCTDNRTLILMNLTTTYSRNYYFQSFKYLGQ GVPKPNNLCYNVSVHFTHQTHCHTTTSSLYPPTSVHDSLEISQSFTSTNFTHTAVHYAAG NVEAQHDTATSHTMWIIPLVIVITIIVLICFKFPQKAWNKFTQYRYSGMLAAA 233
156 CEACAM1-like protein UL7 Q6SWC3 MASDVGSHPLTVTRFRCRVHYVYNKLLILTLFAPVILESVIYVSGPQGGNVTLVSNFTSN ISARWFRWDGNDSHLICFYKRGEGLSTPYVGLSLSCAANQITIFNLTLNDSGRYGAEGFT RSGENETFLWYNLTVKPKPLETTPASNVTTIVTTTSTVTDAKSNVTGNVSLAPQLRAVAG FSHQTPLENNTHLALVGVVVFLVLIVVCIMGWWKLLCSKSEL 222
157 Uncharacterized protein UL6 Q6SWC4 MNGWAGVCLITHCLNTRSRTYVALNMLAFARTPRGVPSCLFNKVWVSRYALVLILMVCAS ESSTSWAVTSNGLPNCSTVTRTAGQDAELHGPAPLSCNVTQWGRYENGSTPVLWCTLRGS RMRVSLGHRVAFGCSWKTFFIYNVSESSGGTYYQKGYNCTDKHITLSCFNLTVVPRAVQS TTTVMTPTLVTNSTFSVSLVALRLTTNSSAFGHAIYQRQQRVENGTLSKNITNLAFTYGS WGVAMLLFAAVMVLVDLGLPQSAWRRWRSHVDDEERGLLM 280
158 Protein UL5 Q6SWC5 MFLGYSDCVDPGLAVYRVSRSRLKLMLSFVWLVGLRFHDCAAFESCCYDITEAESNKAIS RDEAAFTSSVSTRTPSLAIAPPPDRSMLLSREEELVPWSRLIITKQFYGGLIFHTTWVTG FVLLGLLTLFASLFRVPQSICRFCIDRLRDIARPLKYRYQRLVATV 166
159 Envelope glycoprotein UL4 Q6SWC6 MMLRTWISLPMVLLDAYCFCIFVSCSISTTTAPVEWKSPDRQIPMNITCANYSGTVNGNV TFRGLQNKTEDFLHWLLGWGHKSICSFFPKLQGNKEQHYMYGITNLTYNCTYDRLTLLNL TTENSGKYYFKREDVNSTFYYSCYNLTVT 149
160 Uncharacterized protein UL2 Q6SWC7 MAEDSVTILIVEDDDAYPSFGSLPASHAQYGFRLLRSIFLIMLVIWTAVWLKLLRDALL 59
161 Glycoprotein UL1 Q6SWC8 MGVQCNSKLLLLAVLITIILSSILVQAIPHKQKTSYQQLLLQSEHVQIPITVAEGDTICF NVSDNPCNFSSYWNHNNCELCGWTPFYSEYAGYSENKSCHPRFTCLHDTKGLKLHNVTTN DSGIYTRNVYYCDIPCNISDDHKHNVEDFDNCNTTINRTHYIITVSSSRYSKRTNSHVAT HVGWTATVVIIICVLTYVNVTTTLKHRLRTRNNVNHTM 218
162 Membrane protein RL13 Q6SWC9 MHWHLAITWTVIILTFSECYNQTCPCPCICVNSTTVSISTSETTSKNITPTTTTNSKKTT SSIATTTPSLVTTGKVVSTAASSTIISQTNRSHTSNAITTPKTRFEYNITGYVGQEVTLN FTGSWNYIQWFRYGSPGWLYSSEPICTVTSNYHHTFPRGALCFDCDMTKLLIYDLTLNDS GKYVVKRTRHDNQYEEACYSLTVIFANTTSIVTNRTCDRKRTENTDTTNHEIGKHIIETI KKANIPLGIHAVWAGIVVSVALIALYMGNRRRPRKPRYTRLPKYDPDESWTKT 293
163 Uncharacterized protein RL12 Q6SWD0 MRVDRQKRNNFTYRQTVYIILTFYIVYRGKCNSTDTNNSTSTSDSTVSDTSVYSTPNLPS TFFTTLDTSTGSQISTTSNTISSTTNTLAASSITTLNTSTNTTSYTASTLTALSSTHTNS PILSNNATLYTTSLDNTTTDITSSESSINASTIHNTTYSPVTSIAVNCTVAANETNNSSS KNCQQDIGTIRVKSTTLTAEEGKNITIQGNSTWNCPNVVWYRHYNWSTHGHHIYPNRRYQ TPTYQHKILTSHPICHPDVSSPAAYHDLCRSCNKTELRIYDLNTTNSGRYSRRCYKEYNH DGPHEDENFGLTVNPRNDTDNHTTPLCPRYVGTQSEEDEDDDYTLSTITNNNMRKTSHRD ISHGTRTTWALTLICIACILLFFVRRALNKRYRPLRDDISESSFVVRYHPEHED 414
164 Membrane glycoprotein RL11 Q6SWD1 MQTYSTPLTLIIVTSLFLFTTQGSSSNAVEPTKKPLKLANYRATCEDRTRTLVTRLNTSH HSVVWQRYDIYSRYMRRMPPLCIITDAYKETTHQGGATFTCTRQNLTLYNLTVKDTGVYL LQDQYTGDVEAFYLIIHPRSFCRALETRRCFYPGPGRVVVTDSQEADRAIISDLKRQWSG LSLHCAWVSGLMIFVGALVICFLRSQRIGEQDAEQLRTDLDTEPLLLTVDGDLE 234
165 Protein IRL10, TRL10 F5HI32 MYPRVMHAVCFLALGLISYVAVCAENTVTTNCLVKAENTHLTCKCNPNTTSNTNNGSKCH AMCKCRVTEPITMLGAYSAWGAGSFVATLIVLLVVFFVIYAREEEKNNTGTEVDQCLAYR SLTRKKLEQHAAKKQNIYERIPYRPSRQNDNSPLIEPTGTDDEEDEDDDV 170
166 Uncharacterized protein IRL6, TRL6 Q6SWD3 MTLIYVDADNTRNELKATTGSNFTITHRKDPLTTKWKTVFGNNGDQWLCNVTGIGNATVN GNATICVSSCGHNTLDLCNLKSGDSGFFDLSRWFGENMDEYSGDVWHLEVS 111
167 Protein RL5A F5HF23 MDMRKLNTSQGRNLTTVDDRRRFSIGWETWDDGGESLYDVTNNGTTVINTTACVSSCSHT SLVLCNMTQQTDSLYGVGHRLNDEEDGELWRVSVS 95
168 Uncharacterized protein HKLF1, IRL1, TRL1 Q6SWD5 MPATDTNSTHTTPLHPEDQHTLPLHHSTTQPHVQTSDKHADKQHRTQMELDAADYAACAQ ARQHLYGQTQPQLHAYPNANPQESAHFRTENQHQLTNLLHNIGEGAALGYPVPRAEIRRG GGDWADSASDFDADCWCMWGRFGTMGRQPVVTLLLARQRDGLADWNVVRCRGTGFRAHDS EDGVSVWRQHLVFLLGGHGRRVQLERPSAGEAQARGLLPRIRITPISTSPRPKPPQPTTS TASHPHATARPDHTLFPVPSTPSATVHNPRNYAVQLHAETTRTWRWARRGERGAWMPAET FTCPKDKRPW 310